(data stored in ACNUC7421 zone)

EMBL: CP000820.PE414

CP000820.PE414       Location/Qualifiers
FT   CDS_pept        493528..494115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP2181c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09883"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE4"
FT                   /protein_id="ABW09883.1"
FT                   /translation="MVGPLRTTPPPRDPSRRLRRRLCRDQRRSAATEVDADAFRVGAGP
FT                   RFITTQHWRLTQRFPQDMARAIQPITDLIAGELRAGQAAGLLHSTDPDRDAALINKMLM
FT                   AVYHHQTFAAGDETIESVAAHLWAFCLKGIGGPIPVDAAETTARAWPSSSTAVRGRTPG
FT                   ARAGQLKRGPLTSSTRMSPESTSRAQPGHADR"
     gtggtcggcc ccctacgaac caccccacca ccccgagatc cgtctcgacg cctccggcgc        60
     cgtctctgcc gagaccaacg ccgatcggcc gctaccgagg tcgacgcaga tgcattccga       120
     gtcggcgccg ggccgcggtt catcacgacc cagcactggc ggttgaccca gcggttcccg       180
     caggacatgg cccgcgccat ccagccgatc acggacctga tcgccggaga gttgcgagcg       240
     ggccaggcgg ctgggctgct gcactcgacg gatccggacc gtgacgcggc gctgatcaac       300
     aagatgctga tggctgtcta ccaccaccag accttcgcgg ccggcgacga gaccatcgag       360
     agcgtcgcgg cgcacctgtg ggcgttctgt ctgaagggca tcggcgggcc gataccggtg       420
     gacgctgccg agacgacggc cagggcgtgg ccgtcgtcct ctaccgcggt ccgcggtcgg       480
     acccccggag cgcgtgcggg tcagttgaag cggggtcccc tcacgagctc cacccggatg       540
     tcaccggagt ccaccagtag ggcacagccc ggccatgctg acagatag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page