(data stored in ACNUC7421 zone)

EMBL: CP000820.PE417

CP000820.PE417       Location/Qualifiers
FT   CDS_pept        complement(495942..496931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0421"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: mva:Mvan_5937 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09886"
FT                   /db_xref="GOA:A8LGE7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE7"
FT                   /protein_id="ABW09886.1"
FT                   /translation="MTDLAPVLQGFFTDRLARQKKASPNTVAAYRDTCRLLLAFAQSKT
FT                   GKPPSSLSLADLNATLIGEFLHHLEEQRGNGTATRNARLAAIHSLFTYAAPRAPEHAAV
FT                   ISQVLAIPPRRRERAIVSYLTAEEIDALVAAPDRSTWHGRRDRSLLLLDVQTGLRVSEL
FT                   TGLNRQDIHLGAGPHVRCHGKGRKDRATPLTTQTVKVIRTWLAELSPDPTGPLFPTQPG
FT                   GRLSRDAVERLVAKHTATAADTCPSIKEKHVTPHTLRHSAAMTLLKAGVDTSVIALWLG
FT                   HEGTETTQIYLHADMTIKEQALARVQQPGTSPGRYRPPDSLLTFLDNL"
     gtgacggacc tggcccccgt cctgcagggg ttcttcaccg accgactggc ccggcagaag        60
     aaggccagcc cgaacaccgt cgccgcctac cgcgacacct gccggctcct gcttgccttc       120
     gcccagagca agaccggcaa accgcccagc tccctcagcc tcgccgacct gaacgccacg       180
     ctcatcggcg agttccttca tcaccttgaa gaacagcgag ggaacggaac cgccacccgc       240
     aacgcccgcc tggccgcgat ccactccctg ttcacctacg ccgcccccag agctcccgag       300
     cacgccgccg tgatcagcca ggtcctggcg atcccaccgc ggcggcgcga acgggcgatc       360
     gtcagctacc tcaccgccga ggagatcgac gcgctggtcg cggcacccga ccgcagcacc       420
     tggcacggcc gccgcgaccg gtccctgctc ctgctcgacg tccagaccgg gctgcgcgtc       480
     tccgaactca ccggcctgaa caggcaggac atacacctcg gcgccggccc gcacgtccgc       540
     tgccacggca agggccgcaa ggaccgggcc accccactca ccacccaaac cgtcaaggtc       600
     atacggacct ggctcgccga actcagcccc gaccccaccg gcccgctgtt ccccacccag       660
     cccggcggcc ggctctcccg tgacgccgtc gagcgcctcg tcgccaagca caccgccacc       720
     gccgcggaca cctgcccatc gatcaaggaa aagcacgtca ccccgcacac gctgaggcac       780
     tccgcagcca tgacgctact gaaagccgga gtcgacacct ccgtcatcgc actctggcta       840
     ggtcacgaag ggaccgaaac aacccagatc taccttcacg ccgacatgac catcaaggag       900
     caggccctcg cccgcgtcca gcagcccggc accagccccg gccgctaccg gccacccgac       960
     agcctgctca ccttcctcga caacctctag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page