(data stored in ACNUC7421 zone)

EMBL: CP000820.PE420

CP000820.PE420       Location/Qualifiers
FT   CDS_pept        498987..499841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_2660 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09889"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF0"
FT                   /protein_id="ABW09889.1"
FT                   /translation="MRQFLRDDLRLELSAEKTLITHAQTGRARFLGYDIVAQHSDTKIT
FT                   RGRRAVNGAIGLRVPPEVIRNNRGFYSWAAWDTASATGAGLLWRAPTGLDLPVVRVLPD
FT                   GTFLTALITPTIRGARRERLLGAARTGLDLDDINTVPDAFNERGLPVIHLARVIEYDVP
FT                   DRVGNGTGELIVLLSTITDPAGARADELAAAYNERWEKETANDQLKTHLRGPGRVLRSR
FT                   LPDLAYQEIWSYLIVHHAISALTAKASAAADLDPDSISFAKALRLIRRTATGTADIPPS
FT                   GLD"
     gtgcggcagt tccttcgcga cgacctcagg ctggaactgt ccgccgagaa gacgctgatc        60
     acccacgctc agaccgggcg ggcacgtttc ctcggctacg acatcgtggc ccagcactcc       120
     gacacaaaga tcacccgggg tcgccgggcg gtcaacgggg caatcgggct gcgggtcccc       180
     ccagaagtga tcagaaacaa tcggggcttc tactcctggg ccgcgtggga caccgcgtcg       240
     gcgaccggag cgggtttgct gtggcgggcc ccgaccgggc tcgaccttcc cgtcgtgcgt       300
     gtcctgcccg acgggacctt cctgacagcg ctgatcaccc cgacgatccg cggggcccgg       360
     cgggaacgcc tgctgggcgc agcccgaacc ggactcgatc tggacgacat caacaccgtc       420
     cccgacgcct tcaacgaacg cgggctcccc gtcatccacc tcgcccgcgt gatcgagtac       480
     gacgtgcccg accgggtcgg gaacggcacc ggcgaattga tcgtgctgct gtccacgatc       540
     acggacccgg ccggcgcccg cgccgacgaa ctcgccgccg cctacaacga gcgctgggag       600
     aaggaaaccg cgaacgacca gctcaagacc cacctccgtg gccccggacg cgttctgcgt       660
     tcccgcctgc cggacctggc ctatcaggag atctggtcct acctgatcgt ccaccacgcg       720
     atcagcgccc tgaccgcgaa ggcctccgcg gccgccgacc tggaccccga ctcgatctcc       780
     tttgccaaag cactgcgcct gatccgccgc accgccaccg ggacggcgga cattcccccc       840
     tcaggactgg actga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page