(data stored in ACNUC7421 zone)

EMBL: CP000820.PE423

CP000820.PE423       Location/Qualifiers
FT   CDS_pept        502903..503844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A0980
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09892"
FT                   /db_xref="GOA:A8LGF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF3"
FT                   /protein_id="ABW09892.1"
FT                   /translation="MMLTLLKNLARSLAVLLVVTFATFTLMFGNGDGIARAVLGLNARP
FT                   EDVQREVVTLGLDQPLLVQYWHWLRDAVTGDLGESFYTGQSVTEALSSRVPVTLALVII
FT                   TLLLAVVLSVLLGVTAAVKGGWVDRLLQFVTVLGTAIPSFIIAIVLVFTFAIAWRVLPA
FT                   TGYVTPEISVSGWAKSVTLPVLALLVGAVASAAAQFRTAVLDTLGRDYIRTLRARGISE
FT                   RHVIFRHVLRNSAGPGLTVLSLTTLGLLGGAVFVEQVFALPGMGQLANQSAQVNDVPMV
FT                   MGTVLVTIVIVLVVNFLGDLATTVLNPKARIR"
     atgatgctca cgctgctgaa gaacctcgcg cgctcgctgg ccgtgctgct ggtggtcacc        60
     ttcgccacgt tcacgctgat gttcggtaac ggggacggca tcgcccgggc ggtgctgggc       120
     ctgaacgccc ggccggagga cgtccagcgt gaggtcgtca ctctcggtct cgaccagccg       180
     ctgctggtgc agtactggca ttggctgcgc gacgcggtca ccggcgacct cggcgagtcg       240
     ttctacaccg gacagtcggt gaccgaggcg ctctcgtcga gggtgccggt caccctcgcc       300
     ctggtgatca tcaccctgct cctggcggtc gtgctcagcg tgctgctcgg cgtcacggcc       360
     gccgtcaagg gcggctgggt cgaccgtctc ctgcagttcg tgaccgtgct gggcaccgcg       420
     atcccgtcgt tcatcatcgc catcgtcctg gtcttcacct tcgccatcgc ctggcgggtg       480
     ctgccggcca ccggctacgt cacgcccgag atcagcgtct cgggctgggc gaagtcggtg       540
     accctgccgg tgctggcgct gctggtcggt gcggtggcca gcgcggccgc gcagttccgg       600
     accgcggtgc tggacacgct gggccgtgac tacatccgta cgttacgggc ccgcgggatc       660
     agcgaacggc acgtgatctt ccggcacgtg ctgcgcaact ccgccggacc cggtctgaca       720
     gtgctcagcc tgaccacgct gggcctgctg ggcggggcgg tcttcgtcga gcaggtgttc       780
     gcgctgcccg gcatgggcca gctggccaac cagtcggccc aggtcaacga cgtgcccatg       840
     gtgatgggca ccgtgctcgt gacgatcgtg atcgtcctgg tcgtgaactt cctcggtgac       900
     ctggccacca ctgtgctgaa cccgaaggcg aggatccgat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page