(data stored in ACNUC7421 zone)

EMBL: CP000820.PE424

CP000820.PE424       Location/Qualifiers
FT   CDS_pept        503841..505589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0428"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related; SMART:
FT                   AAA ATPase; KEGG: sit:TM1040_2684 oligopeptide/dipeptide
FT                   ABC transporter, ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09893"
FT                   /db_xref="GOA:A8LGF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF4"
FT                   /protein_id="ABW09893.1"
FT                   /translation="MTAERVVGDTRRRVFRQLLRNPQGAVCLAFLAPVVLVAVTSQWLA
FT                   PYSPTETDLDATNAAPFSDGHLLGGDSAGRDILSRLMWGSRQTVLACAIILVISLAVGV
FT                   TSGLVAGFYRGRFEVAAGFVSDVVMSLPGIVLLIALYALTGPNIPAAMAVFGLLIAPTY
FT                   YRLVRNVVLGVRNELYVDAARVAGLSDLRIVGRHVLWAVRAPVIIQSSFVLAAGIGIEA
FT                   GVSFLGLGDPAGASWGIVLQNSFNGIYNNRWAVVWPALLISLTILALVLLGNALSDVLQ
FT                   SSARSKTLSLRARRAAVTAAQQVEPTEDSILVGSSNDVVLSVRGLRVAYPMAGGEIREV
FT                   VHGADLDVRRGEIHGLVGESGSGKSQIAFATLGLLPREALVLGGSVLLDGEDLLADVAK
FT                   MRAARGRRIAYVPQEPMSNLDPSFTIGKQLTYGLRAVTTLDAKQARERIIKLLVRVGIT
FT                   DPEWVMGLYPHEISGGMAQRVLICGAVAADPDVIVADEPTTALDVTVQAEVLELLRELS
FT                   QERGLAMILVTHNLGVVADLCDTVSVMKEGNIVERADVDAIFESPQQAYTRELLSSSRS
FT                   VELMEI"
     atgaccgccg aacgggtagt gggcgacacc cggcgccggg tgttccggca actcctgcgc        60
     aacccgcagg gcgccgtgtg cctggccttt ctcgccccgg tcgtgctggt cgcggtgacc       120
     agccagtggc tggcgccgta ctcgccgacc gaaaccgacc tcgacgccac caacgccgcg       180
     ccgttcagcg acgggcacct gctcggcggg gacagcgccg gccgcgacat cctgtcccgg       240
     ctcatgtggg gctcgcggca gaccgtcctg gcgtgcgcca tcatcctggt gatctcgctg       300
     gctgtcggtg tcaccagcgg cttggtggcc ggcttctatc gtgggcggtt cgaggtcgcg       360
     gcgggcttcg tctccgacgt ggtcatgtcg ctgcccggca tcgttctgct gatcgccctg       420
     tacgccctga ccggcccgaa catcccggcc gcgatggccg tcttcggcct gctgatcgcc       480
     cccacctact accgcctggt ccgcaacgtc gtgctgggcg tgcgcaacga gctctacgtc       540
     gacgcggccc gcgtggccgg cctgtccgac ctgcggatcg tcggccggca cgtgctctgg       600
     gccgtacggg cgccggtcat catccagagc tcgttcgtgc tggccgcggg catcggcatc       660
     gaggccggcg tgtccttcct cggcctcggt gacccggccg gggcgtcgtg gggcatcgtg       720
     ctgcagaact cgttcaacgg catctacaac aaccggtggg ccgtggtctg gccggcgctg       780
     ctgatcagcc tcaccatcct ggccctggtg ctgctcggca acgcgctcag cgacgtcctg       840
     cagtcctcgg cccgcagcaa gacactgtcg ctacgggccc gccgcgctgc ggtgacggcg       900
     gcgcagcagg tcgagccgac cgaggactcg atcctcgtcg ggagctccaa cgatgtcgtg       960
     ctctccgtcc ggggactgcg ggtcgcctac ccgatggccg gcggggagat ccgggaggta      1020
     gtgcacggcg ccgacctgga tgtgcggcgc ggcgagatcc acggcctggt gggggagtcc      1080
     ggctccggca agtcgcagat cgccttcgcc accctgggcc tcctcccgcg cgaggcgctg      1140
     gtcctgggcg gcagcgtcct gctcgacggc gaggatctgc tggccgacgt cgcgaagatg      1200
     cgggcggccc gcgggcgccg catcgcgtac gttccgcagg agccgatgtc caatctggac      1260
     ccgtccttca ccatcggcaa acagttgacg tacgggctgc gcgcggtaac cactctcgac      1320
     gcgaaacagg cccgggagcg gatcatcaaa ttactggtcc gggtgggcat caccgatccc      1380
     gagtgggtga tgggcctgta cccgcacgag atctcgggtg gcatggccca gcgcgtgctg      1440
     atctgcggcg cggtcgccgc cgacccggac gtcatcgtgg ccgacgagcc caccaccgcc      1500
     ctcgacgtca ccgtccaggc cgaggtcctc gaactgctgc gcgaactgag ccaggagcgc      1560
     ggtctggcca tgatcctggt gacccacaac ctcggcgtcg tcgcggatct gtgcgacacc      1620
     gtgagcgtga tgaaggaagg aaacatcgtc gaacgcgccg acgtcgacgc catcttcgag      1680
     tccccgcaac aggcgtacac ccgggaactg ctctcgtcct cccgcagcgt cgagctgatg      1740
     gagatctga                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page