(data stored in ACNUC7421 zone)

EMBL: CP000820.PE425

CP000820.PE425       Location/Qualifiers
FT   CDS_pept        505591..506400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0429"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_3570 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09894"
FT                   /db_xref="GOA:A8LGF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF5"
FT                   /protein_id="ABW09894.1"
FT                   /translation="MTDQPLLRVRDLVVRFAGRRRTSTTVIHGVSFDLAAGETLSLVGE
FT                   SGSGKTTIGRAILGLAPVSEGTVEFRSEIISNVPRARRRELARDVQVVFQDPYSSLNPS
FT                   MTVGDILVEPLTTAGVEGGRTRVKELLDAVGLPADAANRYPREFSGGQRQRVAIARALA
FT                   LDPAVIVCDEPSSALDVTTQARVLRLFRDIQEATGVAYLFISHDLGVVNEISDRIAVLY
FT                   RGEIVELGAANQVATAPRHEYTRRLQMAAPVADPRKQRERRRLRLAL"
     atgaccgatc aaccgctgct gcgcgtccgc gacctggtcg tccggttcgc cggccgccgg        60
     cggacctcga ccaccgtcat ccacggcgtc tccttcgacc tcgccgccgg cgagaccttg       120
     agcctggtcg gcgagtccgg ctcgggcaag accaccatcg ggcgggccat cctcggcctg       180
     gccccggtca gcgagggcac ggtcgagttc cgcagcgaga tcatcagcaa cgtcccccgg       240
     gcccgccgcc gcgagctcgc ccgcgacgtg caggtcgtct tccaggaccc gtactcgtca       300
     ctcaacccgt ccatgacggt cggcgacatc ctcgtcgaac cgctcaccac ggccggtgtc       360
     gagggcggac gcacccgcgt gaaagagctg ttggacgcgg tcggcctgcc cgctgacgcg       420
     gcgaaccgat acccgcggga gttctccggc gggcagcgcc agcgggtggc catcgcccgc       480
     gccctcgccc tggatccggc ggtgatcgtc tgcgacgagc cgtcgagcgc gctcgacgtg       540
     accacgcagg cgcgcgtgtt gcgcctgttc cgcgacatcc aggaggcgac cggggtggcc       600
     tacctgttca tcagccacga cctcggcgtc gtcaacgaga tcagcgaccg catcgccgtc       660
     ctgtatcgcg gagagatcgt cgaactcggt gcggcgaacc aggtcgcgac cgcaccgcgg       720
     cacgaataca cccgccggct gcagatggcc gcgccggtcg ccgacccgcg caagcagcgc       780
     gagcggcgcc ggctgcgcct ggccctctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page