(data stored in ACNUC7421 zone)

EMBL: CP000820.PE426

CP000820.PE426       Location/Qualifiers
FT   CDS_pept        506431..508965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0430"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: ani:AN0711.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09895"
FT                   /db_xref="GOA:A8LGF6"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF6"
FT                   /protein_id="ABW09895.1"
FT                   /translation="MVQPCAPRFEHRTEPGPVLGLGAPAPRLSWTVTRAEEGWRQTAYE
FT                   VQVAGKVFTVRSAEQVLVPWPARPLRSRERAEVKVRVAYGDHWSPWSEAATVEAGLLDA
FT                   ADWTARFISPVDPGERAPVVVGHVEVPGPVRSARLYATAHGIYVPSINGRRVDDTVLAP
FT                   GWTSYEHRLRYHVYDVTTLIRPGENVLEFVLGNGWYRGRLGWTNQRAIYGDRLALLAQL
FT                   EITTFDGAVRVLATDGTWHARPSEVLADDLYDGQTTDLRPHDAPATGVDIVEGDLTRLV
FT                   APDGPPIRPTSVLPARKVWTSPAGKTLVDFGQNAVGWIRLRVRDLPAGTTVVVRHAEVL
FT                   EDKELGTRPLRSARATDTWVLSGHDEVLEPSLTLHGFRYAEVTGVPDLREQDIALVVVG
FT                   SDLRRTGWFSSSHEQLNQLHENVVWSTRGNFVDLPTDCPQRDERLGWTGDIQIFGPTAT
FT                   FLYDTAGLLRSWLADLAAEQRPDGSVPHVVPEIDRAPEFRTPAAAWGDAATVVPWTLYQ
FT                   RTGDLQMLERQLPSMSAWVDKVAALAGPDRLWRGGFQFGDWLDPTAPPENPGRAKADPD
FT                   VVATAHFARSSWIVAESARLLGRAADAEKYRTLTDEVRAAFVRAFVTPQGRIHSDAQTL
FT                   YALAIEWDLLPEAEQRVAAGHRLAELVRDGGFHIATGFVGTPLVCDALTSTGHLDVAYR
FT                   LLLQTQCPSWLYPVTMGATTVWERWDSMRPDGTINPGEMTSFNHYALGAVADWLHRTVA
FT                   GLAPAAPGYRRLLVHPRLTPELTGAAATHLTPYGKASVSWLRSAGHLRLDVHVPVGASA
FT                   EVHVPGAEQPVTVGHGDHRWLVADPVSRSEGR"
     atggttcagc cctgcgcacc tcgtttcgaa caccgcaccg agcccggccc ggtgctcggc        60
     ctcggcgcac cagccccccg gctctcctgg accgtcacgc gcgcggagga gggctggcgc       120
     cagacggcct acgaggtcca ggtcgccggc aaggtcttca ccgtgcgcag cgccgagcag       180
     gtgctggtcc catggccggc ccggccgttg cgctcacgcg agcgggccga ggtcaaggtc       240
     cgggtggcgt acggcgatca ctggagcccg tggagcgaag cggccaccgt cgaggcgggc       300
     ctgctggacg cggccgactg gacagcgcgc ttcatcagcc cggtcgaccc gggcgaacgg       360
     gcgcccgtcg tcgtcggcca cgtcgaggtg cccgggccgg tccgcagcgc tcggctgtac       420
     gccaccgccc acggcatcta cgtaccgtcg atcaacggcc gccgcgtcga cgacaccgtc       480
     ctcgcgccgg gttggacatc gtacgagcac cggctgcgct accacgtcta cgacgtcacg       540
     accctgatcc ggccgggcga gaacgtcctg gagttcgtgc tcggcaacgg ctggtaccgc       600
     ggacggctcg gctggaccaa ccagcgcgcg atctacggcg accgcctcgc cctgctcgcc       660
     cagctggaga tcaccacctt cgacggcgcc gtccgcgtac tggcgaccga cggcacctgg       720
     catgcccggc cgagcgaggt gctggccgac gacctgtacg acggccagac gaccgacctg       780
     cgcccgcacg acgcaccggc gaccggcgtc gacatcgtcg agggcgatct gacgcggctc       840
     gtcgccccgg acggccctcc gatccggccg accagcgtgc tgcccgcccg caaggtgtgg       900
     acctccccgg ccggcaagac gctcgtcgac ttcggccaga acgccgtcgg atggatccgc       960
     ctgcgcgtcc gggacctgcc cgcgggaacg acggtcgtgg tccgccacgc cgaggtgctg      1020
     gaagacaagg aactgggcac ccggccgctg cgatcggccc gcgccaccga cacctgggtg      1080
     ctgtcgggcc acgacgaggt gctcgagccc tcgctgacgt tgcacggctt ccgctacgcc      1140
     gaggtcaccg gagtgccgga cctgcgcgag caggacatcg cgctggtcgt cgtcggctcg      1200
     gacctgcgcc gcaccggctg gttctcctcc tcgcacgaac aactgaacca gctgcacgag      1260
     aacgtcgtct ggagcacccg cggcaacttc gtcgacctgc ccaccgactg cccgcagcgc      1320
     gacgagcgcc tcggctggac cggcgacatc cagatcttcg ggccgaccgc gaccttcctg      1380
     tacgacaccg ccggcctgct gcgctcctgg ctggccgacc tggccgccga gcagcgcccc      1440
     gacggctcgg tgccgcacgt cgtccccgaa atcgatcgcg ccccggagtt ccgcacgccc      1500
     gcggcggcct ggggcgacgc cgccaccgtc gtgccctgga cgctctacca gcgcaccggc      1560
     gacctgcaga tgctcgaacg gcaactgccg agcatgagcg cctgggtcga caaggtcgcc      1620
     gccctggccg gcccggaccg gctctggcgc ggcggcttcc agttcggtga ctggctcgac      1680
     ccgacagctc cgccggaaaa ccccggccgg gccaaggccg accccgacgt ggtggccacc      1740
     gcccacttcg cccgctcgtc gtggatcgtg gccgaatcgg cccgcctgct cggccgggcc      1800
     gccgacgcgg agaaataccg cacgctgacc gacgaggtac gggccgcctt cgtccgggcc      1860
     ttcgtgacgc cgcagggccg gatccactcc gacgcgcaga ccctgtacgc gctggccatc      1920
     gagtgggatc tgctgccgga ggcggagcag cgcgtggcgg ccgggcaccg gctggccgag      1980
     ctcgtgcgcg acggcgggtt ccacatcgcc accggcttcg tcggcacgcc actggtctgc      2040
     gacgccctca ccagcacggg ccacctcgac gtcgcgtacc gcctgttgtt gcaaacgcag      2100
     tgcccgtcct ggctctaccc ggtcaccatg ggcgccacca cggtgtggga acgctgggac      2160
     agcatgcgcc cggacggcac catcaacccg ggggagatga cctccttcaa ccactacgcc      2220
     ctgggcgccg tggccgactg gctgcaccgc acggtggccg ggctcgcacc cgccgctccc      2280
     ggatatcggc gcctgctcgt gcacccccgg ctgacgccgg agctcaccgg cgctgcggcc      2340
     acccatctga ccccgtacgg gaaagcctcg gtgtcctggc ttcgctcggc cggccacctg      2400
     cggctcgacg tgcacgtgcc ggtcggcgcg tcggccgagg tgcacgtgcc gggcgcggag      2460
     cagcccgtga cggtcggcca cggcgaccac cgctggctcg tggctgaccc ggtgtcgcgc      2520
     tccgaggggc ggtga                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page