(data stored in ACNUC7421 zone)

EMBL: CP000820.PE428

CP000820.PE428       Location/Qualifiers
FT   CDS_pept        510321..512048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN0478.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09897"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF8"
FT                   /protein_id="ABW09897.1"
FT                   /translation="MKAVLSSLLLTAGLILVPAGAASAAPPDCAAATPGGPVQVTPGCV
FT                   DPLYADPVVDSEQDLSTPVTHRRVSGHFDGTGVKFTIYLPPARQWQGRFFQYTYPISTE
FT                   NALDRSVAFGAASGAYTLQTSGTGGYRHAAAAAKFAETAAAAYYRSGSRRIYGYLYGPS
FT                   GGSFQTVGAIENTTGVWEGAVPVVLGVPTSIPINFFVRAQARMVLRDVADQIADAVRPG
FT                   GSGNPYTGLTPVQAAMLHETTSLGVPLKAWADPDYVLGLSAPDGLLGFGAVIKQLDPTY
FT                   ADDFWSKPGYLGTEQSALGDIVRAELARTGDRWAVALPSYYRHQVPPAGEGYDVFDSLR
FT                   GRYPQRPLLVGPAIATSVAGGGTYTGRINGKVIVVDNLVDSDAYPWHADWYARRVQSPG
FT                   DFRLYYNDNADHLEGPVTGAKASRIVSYDPIVEQALRDLAAWAERGVRPPQSTRYTVTG
FT                   GQVRVPSTAAQRRGIQPVVDLTVRGRDRVDVNAGEKVDFRAQVATPPGAGRIVSAGWDV
FT                   TGSGTFTPATTGFTASHRFTEPGTYYVSLKVAASRSGHAESFAMVENLDRVRVVVHPR"
     atgaaagctg tcctgagctc tctccttctc accgccggcc tcatcctcgt cccggccggt        60
     gccgcgtcgg ccgcaccgcc cgactgcgcc gccgccacgc ccggcgggcc ggttcaggtc       120
     acgcccggct gtgtcgaccc gctctacgcc gaccctgtcg tcgacagcga gcaggacctg       180
     agcaccccgg tcacgcatcg ccgggtgtcc gggcacttcg acggtacggg agtcaagttc       240
     acgatctacc tgccgccggc caggcagtgg cagggccgct tcttccagta cacgtacccg       300
     atctcgaccg agaacgccct cgaccggtcg gtcgccttcg gggccgccag cggcgcgtac       360
     accctccaga ccagcggcac aggcggctac cgccacgccg ccgcggccgc gaagttcgcc       420
     gagaccgcgg cggccgccta ctaccggtcc gggtcccggc gaatctacgg ctacctgtac       480
     ggcccgtccg gcggctcctt ccagaccgtc ggcgccatcg agaacaccac cggagtgtgg       540
     gagggcgcgg tcccggtcgt gctcggcgtg cccacctcca tccccatcaa cttcttcgtg       600
     cgcgcgcagg cccggatggt cctgcgggac gtggccgacc agatcgcgga cgccgtacgc       660
     ccgggcggct ccggtaaccc gtacaccggc ctcacaccgg tgcaggcggc gatgctgcac       720
     gagaccacga gcctgggcgt tccactcaag gcctgggccg accctgacta cgttctcggc       780
     ctgtcggcgc cggacggcct gctcggcttc ggcgccgtga tcaagcagct cgaccccacg       840
     tacgccgacg acttctggtc caagcccggc tacctcggca ccgagcagtc ggcgctcggc       900
     gacatcgtcc gggccgagct tgcccggacc ggcgaccgct gggccgtcgc cctgccctcc       960
     tactaccgcc accaggtccc gccggcgggc gagggttacg acgtcttcga ctcgctgcgc      1020
     ggccgctatc cgcagcggcc gttgctggtc ggcccggcga tcgcgaccag cgtcgccggc      1080
     ggcggcacct acaccggccg gatcaacggc aaggtcatcg tggtcgacaa cctggtcgac      1140
     agcgacgcgt acccgtggca cgccgactgg tacgcccgcc gcgtccagtc cccgggcgac      1200
     ttccgcctgt actacaacga caacgccgac catctcgaag gcccggtcac cggggccaag      1260
     gccagccgga tcgtctcgta cgacccgatc gtggagcagg cgctgcgcga cctcgcggcc      1320
     tgggccgagc gcggcgtgcg cccaccgcag tccacgcgtt acacggtcac cggcggccag      1380
     gtgcgcgtcc cgtcgacggc cgcccagcgg cgcggcatcc agcccgtcgt cgacctcacc      1440
     gtccgcggcc gcgaccgcgt cgacgtcaat gccggcgaga aggtcgactt ccgggcccag      1500
     gtcgcgacac cgcccggcgc cggaaggatc gtctccgccg gctgggacgt caccggatcc      1560
     ggcaccttca caccggccac cacgggcttc accgccagcc accggttcac cgaacccggc      1620
     acctactacg tgtccctcaa agtggccgcg tcccggtccg gccacgcgga gtcgttcgcc      1680
     atggtcgaaa acctggatcg ggtccgcgtc gtcgtccacc cccgctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page