(data stored in ACNUC7421 zone)

EMBL: CP000820.PE429

CP000820.PE429       Location/Qualifiers
FT   CDS_pept        512058..513767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09898"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032260"
FT                   /db_xref="InterPro:IPR041239"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF9"
FT                   /protein_id="ABW09898.1"
FT                   /translation="MLTHFITVGQVLDAPGGRDVLERFLPQAVDRADVRELLVLFFLRV
FT                   TPGLRDDEQARAAFWAEIDALMEPVILRPHAAAIAPSAVGVSAPHASAPWTVAGSPTRW
FT                   GLLEIQLSGPSDGNPFIDVELTAEFRCGERSWTVGGFYDGDGTYRLRALAEQEGTWQFV
FT                   TSSTTPALDGIEGEVTVGPAAPGAHGPVRVDGFHFAYADGTRYRPWGTTAYAWNHQDDK
FT                   TQEQTLETLAASPFTKLRMCLFPKHFVFNNAEPVQFPFPRVNGSFDHTRFDVEFFARLD
FT                   EQVRRLGELGIEADVILFHPYDKWGFSDLGRAVDERVVRYLVRRLAGYAHVWFSLANEY
FT                   DAVPGKTIADWDRIGETLTAEDPHGHPVSIHNFIEHFDHTRPWITHASVQHGRVEEVTG
FT                   WRERWGKPVVIDETGYEGDLEFDWGNLTGEEMLRRFWEGAVRGGYVGHGETYWNAEERI
FT                   WWAKGGQLTGTSPRRIGFLAEIVAASPTGVLEPLPSDYDLPWAGVQDEYLVNYYGLGRP
FT                   RERHILLPPGRWHVDVLDTWECTVERLPGTYETLAVVPLPAKPYQAVRLVKA"
     atgctgacgc atttcatcac cgtcgggcag gtgctcgacg cgccgggcgg acgagacgta        60
     ctggaacggt tcctgccgca ggccgtcgac cgcgccgacg tccgtgagct tctcgtcctg       120
     ttcttcctgc gggtgacccc ggggctgcgc gatgacgagc aggccagggc ggcgttctgg       180
     gccgagatcg acgcgctgat ggaaccggtc attctccggc cgcacgccgc cgccatcgcg       240
     ccatcggcgg tcggcgtatc ggcgccgcac gcgtcggcgc cgtggaccgt cgcaggctca       300
     cccacgcggt gggggctgct ggagatccag ctgagcggtc cgtcggacgg gaacccgttc       360
     atcgacgtcg agctgaccgc cgagttccgg tgcggcgagc ggtcctggac ggtcggcggc       420
     ttctatgacg gcgacggaac ctaccggctg cgggcgctcg ccgaacagga ggggacgtgg       480
     cagttcgtga cctcctccac gaccccggcg ctggacggga tcgagggcga ggtgaccgta       540
     ggcccggcgg cgccgggagc gcacgggccg gtccgggtgg acggcttcca ttttgcgtac       600
     gcggacggaa cccgttaccg gccgtggggg accaccgcgt acgcctggaa ccaccaggac       660
     gacaagacgc aggagcagac gctggaaacg ctggccgcgt cgcccttcac caagctgcgt       720
     atgtgcctgt tccccaagca tttcgtcttc aacaacgccg agcccgtcca gttcccgttc       780
     ccacgggtca acggctcctt cgaccacacg cggttcgacg tcgagttctt cgcgcgcctc       840
     gacgagcagg ttcgccgtct cggtgaactc ggcatcgagg ccgacgtcat cctcttccac       900
     ccgtacgaca aatggggttt ctccgatctg ggacgggcgg tggacgagcg agtcgtcagg       960
     tacctcgtgc ggcgcctggc cggctacgcg cacgtctggt tctcgctggc caacgagtac      1020
     gacgcggtac ccggcaagac gatcgcggac tgggaccgga tcggtgagac cctcaccgcc      1080
     gaggacccgc acgggcaccc ggtgtccatc cacaacttca tcgagcactt cgaccacacc      1140
     cggccgtgga tcacccacgc cagcgtccag cacggccggg tcgaggaggt caccggctgg      1200
     cgcgagcgct ggggcaagcc ggtggtcatc gacgagaccg gttacgaggg cgacctcgag      1260
     ttcgactggg gcaacctgac cggcgaggag atgctgcgcc gattctggga aggcgcggtg      1320
     cgcggcggtt acgtcggtca cggcgaaacg tactggaacg ccgaggagag gatctggtgg      1380
     gcgaagggcg gtcagttgac cggcacgagc ccgcgccgga tcggcttcct ggccgagatc      1440
     gtcgccgcct caccgaccgg tgtgctcgag cctctaccgt ccgactacga cctgccgtgg      1500
     gccggtgtcc aggacgagta cctggtcaac tactacggcc tcggccggcc gagggagcgt      1560
     catatcctcc tgcccccggg ccgctggcac gttgacgtcc tggacacctg ggagtgcacc      1620
     gtcgagcggc tgcccggcac gtacgaaacc ctcgcggtcg tcccgctgcc ggccaagccc      1680
     taccaagccg tgcggctggt gaaggcctga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page