(data stored in ACNUC7421 zone)

EMBL: CP000820.PE432

CP000820.PE432       Location/Qualifiers
FT   CDS_pept        517180..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PC00041 probable transcriptional regulator protein,
FT                   LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09901"
FT                   /db_xref="GOA:A8LGG2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG2"
FT                   /protein_id="ABW09901.1"
FT                   /translation="MVSTPDSQEARRVTIQDVAREAGVSVSAVSKVVRDAYGVSEGMRE
FT                   KVTAAIDALGYRPHTGARAMRGRSYSVGVMLTELTSPFQPQIINGITAQFEPTPYQEIL
FT                   IAAGTSPDRQKRSIEALIDRQVDGLIVIAPWMEQAWLEKLGASLPTVVLARHGGSGTFD
FT                   TIVGDDFEGARLMVDRLVALGHRRIVHTSQPSGGLERPYVLSHTPRLDGYEETMRRHGL
FT                   EPDVIVTSYSEEGGYEAARQALARPIPPTAIFAGADIAALGVLRAAEELGLRVPEDLSV
FT                   AGYDNIYMSTIGRISLTTIDQSAQLTGSRSARLLLERIDGRTQPVHYLIAPRLVARDTT
FT                   A"
     gtggtctcga cgccggacag ccaggaggcg cgccgcgtca ccatccagga cgtggcacgc        60
     gaggccggcg tgtcggtctc ggccgtctcc aaggtcgtcc gggacgcgta tggcgtcagc       120
     gagggtatgc gggagaaggt caccgccgcc atcgacgcgc tcggctaccg cccgcacacc       180
     ggcgcccggg ccatgcgcgg ccgctcgtac tccgtcggcg tgatgctcac cgagctgacc       240
     tcgccgttcc agccgcagat catcaacggc atcacggcac agttcgagcc gacgccgtac       300
     caggagatcc tgatcgccgc cggcacctcg cccgaccggc agaagcgcag catcgaggcc       360
     ttgatcgacc ggcaggtcga cgggctgatc gtcatcgcgc cctggatgga gcaggcgtgg       420
     ctggagaagc tgggcgcgag cctgccgacg gtcgtgctgg cccggcatgg cggctccggc       480
     accttcgaca cgatcgtcgg cgacgacttc gagggcgccc gcctcatggt cgaccgcctg       540
     gtggccctcg ggcaccggcg catcgtgcac accagccagc cctcgggcgg cctggaacgc       600
     ccgtacgtcc tgtcgcacac gccacggctc gacggctacg aggagacgat gcgaaggcac       660
     gggctggagc cggacgtcat cgtcaccagc tactcggaag aaggcggata cgaggccgcc       720
     cggcaagcgc tggcccgtcc catcccgccg accgccatct tcgccggcgc ggacatcgcc       780
     gcgctgggcg tgctgcgcgc ggccgaggaa ctcgggctgc gggttccgga agacctcagc       840
     gtcgccgggt acgacaatat ctacatgtcg acgatcggcc gcatctcgct gaccacgatc       900
     gaccagtcgg cccagctcac cggttcccgc agcgcccggt tgctgctgga gcgcatcgac       960
     ggccgcaccc aaccggtgca ctacctcatc gcgccgcgcc tggtggctcg cgacacgacc      1020
     gcctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page