(data stored in ACNUC7421 zone)

EMBL: CP000820.PE434

CP000820.PE434       Location/Qualifiers
FT   CDS_pept        complement(519779..519985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09903"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG4"
FT                   /protein_id="ABW09903.1"
FT                   /translation="MWTVLSADTDLKPQIATTYNSYPGTVANRSTSPCSAQCGGSPATV
FT                   LTGLLHPAMAADLDRKSSREQAC"
     ttgtggacgg ttctgtccgc cgacacggat ctcaaaccgc agatcgccac cacctacaac        60
     tcctacccgg gcacggtcgc gaaccggtca acctcaccct gctcagcaca gtgcggcggc       120
     agccccgcaa cggtcctgac gggtctgttg catccagcga tggcagccga tcttgaccgt       180
     aaatcttctc gcgaacaggc gtgctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page