(data stored in ACNUC7421 zone)

EMBL: CP000820.PE437

CP000820.PE437       Location/Qualifiers
FT   CDS_pept        522170..523276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0441"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09906"
FT                   /db_xref="GOA:A8LGG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG7"
FT                   /protein_id="ABW09906.1"
FT                   /translation="MPAGQGPHRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKDVEL
FT                   LVLRHQVAVLRRQVNRPALEPADRVILAALSRLLPRAGWGSFFVTPATVLRWHRELLAR
FT                   KWTYPRKTPGRPPVRREIRELVLRLARENPTWGHRRIQGELIGLGYPVGVATVWRILHR
FT                   AGVDPAPRRADASWRTFLSAQASGLLACDFFMVDTVFLQRIYVFFVVEHATRRVHVLGV
FT                   TKHPTSAWVTQRARNLLMDLDERCHRFRFLIRDRDMKFTASFDAVFIGAGIDVVRTPPQ
FT                   APKANAIAERWVGTARRECTDRLLIVSERHLTSVLTTYAEHFNTHRPHRSLGQHPPDSP
FT                   PVVAPTLESTVRRTRILGGMINEYRNAA"
     ttgcctgccg gacagggccc acatcgggca ggctggatgg tcatggtgtg gtcgttgctc        60
     tacgccctga cacgcaacgc tctcgggctg atgctgctcc gggtccgtgg ggacaccgcg       120
     aaggacgtcg agctcctcgt cctgcggcat caggtggcgg tgttgcgacg gcaggtgaac       180
     cgcccggccc tggaaccggc agatcgggtg atcctcgcag ccctgtcccg gctgctaccc       240
     cgggccggct ggggttcgtt cttcgtcacc ccggccaccg tgctgcgctg gcaccgtgag       300
     ctcctcgcgc gaaaatggac ctatccgcgc aagacccctg ggcggccgcc ggtccgccgg       360
     gagatccgtg agctggttct gcgtctcgcg cgggagaatc cgacctgggg ccaccgcagg       420
     atccagggag aactgatcgg gctgggctac ccggtcgggg tcgccaccgt ctggcggatc       480
     ctgcaccgcg ctggtgtcga ccccgcgccg cggcgggctg acgcctcttg gcgtacgttc       540
     ctgtccgcgc aggcctccgg cctgctggcc tgcgatttct tcatggtgga cactgtgttc       600
     ctgcagcgga tctacgtgtt cttcgtcgtc gaacacgcca cgcgccgtgt tcatgttctc       660
     ggggtcacga agcatccgac ctcggcgtgg gtcacccagc gtgcgcggaa cctgctgatg       720
     gatctcgacg agcgttgcca ccggttccgg ttcctgatcc gtgaccgcga catgaagttc       780
     acggcttcct tcgacgctgt cttcatcggg gccggtatcg acgtggtacg cacacccccg       840
     caagctccga aggcgaacgc gatcgcggaa cgctgggtcg gcaccgcccg ccgcgaatgc       900
     accgacagac tgctgatcgt ctccgaacga cacctgacgt cagtcctcac cacctacgcc       960
     gagcacttca acacccaccg gcctcaccgc tccctcggcc agcacccacc cgactcgcca      1020
     cccgtggtcg ccccgacgtt ggagtccacc gtccgtcgca cacgcatcct cggcggcatg      1080
     atcaacgaat atcgcaacgc cgcctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page