(data stored in ACNUC7421 zone)

EMBL: CP000820.PE438

CP000820.PE438       Location/Qualifiers
FT   CDS_pept        complement(523525..523671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09907"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG8"
FT                   /protein_id="ABW09907.1"
FT                   /translation="MAAGLVEGDLALLNEDLLFWDEVQDLFDPDLMGALPDLFVPDASV
FT                   ADW"
     gtggcggccg ggctggtcga aggggatctg gccctcctca acgaggatct tctcttctgg        60
     gacgaggtcc aggacctctt cgatcccgac ctcatgggag cccttcccga cctcttcgtc       120
     cccgacgcct ccgtcgcgga ctggtag                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page