(data stored in ACNUC7421 zone)

EMBL: CP000820.PE440

CP000820.PE440       Location/Qualifiers
FT   CDS_pept        524591..525511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0303 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09909"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH0"
FT                   /protein_id="ABW09909.1"
FT                   /translation="MVAPGDRHGFAALDGVEQVGEAPGCLGGGHRPHVPILSDNQIRLL
FT                   WCRPESTMPSSKAGKTSRPGSRCPAPTTATSSRPPSVTARTPSSPRTSSTSPRRRSARS
FT                   ACGRPATDYSSLFSRDPDGDLVAVGTSAGNWATLTDTHGDLVAAFTTTGTLTDSRSYDP
FT                   FGEPVVAGNPAVHVGFQGSWTDPDTDRVSAQARWYTPGTGTFASRDTANLPISGTAAAN
FT                   RYTYADANPLTYNDPTGFFADPIAGALRLDRFPSPIVYRAAPATHGPEAGGAAPDHGQV
FT                   LGRRQRRPRPMQRARIKPAPRVPRP"
     atggttgccc cgggtgatcg tcacggtttc gccgcgctcg atggcgtcga gcaggtcgga        60
     gaagctccgg gatgcctcgg tggcggtcat cgtccgcatg tacccatcct atctgataat       120
     cagattcggc tcctctggtg tcggcccgag tcgacgatgc cctcgtcgaa ggctgggaag       180
     acctcgaggc cgggttcacg ctgcccggct ccgacgaccg ccacgtcgtc gcgaccgccg       240
     tccgtgacgg cgcgcacgcc atcgtcaccg cgaacctcgt cgacttcccc acgtcgacgc       300
     tcggcccgct cggcctgcgg gcgacccgcc accgactact cgtcgttgtt ctcccgcgac       360
     cccgacggtg atctggtcgc ggtcggtacc tcggccggga actgggccac cctcaccgac       420
     acccacggcg atctcgtcgc cgccttcacc accaccggca ccctcaccga cagccgcagc       480
     tacgacccgt tcggtgaacc cgtcgtcgcg gggaacccgg ccgtgcatgt cggcttccag       540
     ggcagctgga ccgatccgga caccgaccgg gtctccgccc aggcccgctg gtacaccccg       600
     ggcaccggca cgttcgccag ccgtgacacg gcgaacctgc ccatcagcgg taccgccgcc       660
     gccaaccgtt acacctacgc cgacgcgaac ccgctgacct acaacgaccc caccggtttc       720
     ttcgccgacc ccatcgccgg cgctctccgc ctcgacagat ttcccagccc catcgtttac       780
     agggccgccc ccgccaccca tggtcctgaa gccggaggcg cagcgccaga tcacggacag       840
     gttctgggcc ggcgtcaacg ccgccctcgc cccatgcaga gggctcggat caaaccggcc       900
     ccccgcgtcc cccggccctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page