(data stored in ACNUC7421 zone)

EMBL: CP000820.PE441

CP000820.PE441       Location/Qualifiers
FT   CDS_pept        525541..526257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0446"
FT                   /product="Hedgehog/intein hint domain protein"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   stp:Strop_0303 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09910"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH1"
FT                   /protein_id="ABW09910.1"
FT                   /translation="MGADKFWAGVRASLAGVKPPAPARGYTFDPSRASQDDLNRTLARG
FT                   SAANPTVCSAQCPGSTVSGGLSRDRCGDACMYIGVGAGIAAIAGVTVLTDGLIAAPEGA
FT                   AAGGLGRAVRGCTGRNSFDGATGVLMADGTHKPIRDVHVGDQVLATDPTTGRTEPHTVT
FT                   NLIIGTGDKHLVDITLDTPGPDATLTATDHHPFWDETDHTWVDADDLTTTNRLRTPTGT
FT                   LLAVVACGVPEVGLSL"
     atgggagcgg acaagttctg ggccggcgtc agagcctccc tcgccggggt gaaaccaccc        60
     gccccggcac gcggctacac tttcgatccc tcccgcgcct cgcaggacga cctgaaccgc       120
     accctggcgc gcgggagcgc agcaaacccc acagtgtgca gcgctcagtg cccaggcagc       180
     accgtcagcg gcggcctttc tcgcgatcgt tgcggcgacg cttgcatgta cataggcgtc       240
     ggtgccggca tcgccgccat agccggcgtc accgtgctga ccgatggtct catcgcggca       300
     ccggaaggcg ctgccgccgg tggtctcggc cgcgccgtcc gcggctgcac cggccgcaac       360
     agtttcgacg gcgccaccgg cgtcctcatg gccgacggaa cccacaaacc catccgcgac       420
     gtccatgtcg gtgaccaggt cctcgccacc gaccccacca ccggccgcac cgaaccccac       480
     accgtcacca acctgatcat cggcaccggc gacaaacacc tcgtcgacat caccctcgac       540
     acccccggcc ccgatgccac cctcaccgcc accgaccacc accccttctg ggacgaaacc       600
     gaccacacct gggtcgacgc cgacgacctc accaccacca accgcctccg cacccccacc       660
     ggtaccctcc tcgcggtagt cgcctgtggg gtgccagaag tcggcctgag cctgtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page