(data stored in ACNUC7421 zone)

EMBL: CP000820.PE445

CP000820.PE445       Location/Qualifiers
FT   CDS_pept        530652..531593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0450"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_1312
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09914"
FT                   /db_xref="GOA:A8LGH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH5"
FT                   /protein_id="ABW09914.1"
FT                   /translation="MLAYVLRRLGAGVVLALLVTLITFFLLSLSFDSVVRSLLGPSATP
FT                   ETLHARKAQMGLDRPVLVQYLDWLAHAARGDLGVSYFTSEPVVQAVPTRLGVTLSVIVV
FT                   ALILTALISVMLGVLAASRGGVVDRVAQGASLVGQLVPHMLIAIILVTVLAINLKLLPP
FT                   TGFTHLTDDPGRWAATITIPVITLTVASIANATAQVRGAMVDELSKDYIRTLRTRGISS
FT                   RSILLRHALRNAAGPALTVLSLEFITMFGGVLILENIFALPGFGTYAFNASLQGDVPII
FT                   MGVTLFAVLLIVTVNLVVDLVNGWLNPKARIH"
     ttgctagcct atgtactccg gcggctcggc gcaggtgtgg tgctcgctct cctcgtcaca        60
     ttgatcacgt tcttcctgct gagcctttcg ttcgacagcg tggtcaggag cctccttggc       120
     cccagcgcga cgcccgagac gctgcatgca cgcaaagctc agatggggct cgatcggccg       180
     gtcttggtcc agtatctcga ctggctggcc cacgcagcgc gaggcgacct cggcgtctcg       240
     tacttcacca gcgagccggt cgtccaggcc gtgccgacgc ggctgggcgt caccctgtcc       300
     gtcatcgtcg tcgcactgat cctcacggcc ctcatcagtg tcatgctcgg tgtgctggcg       360
     gccagccgtg gtggtgtcgt cgaccgcgta gcccagggag cctcgctcgt cggccagctc       420
     gtacctcaca tgctgatcgc gatcatcctg gtcaccgtgc tcgccatcaa cctgaagctg       480
     ctccccccca ccggtttcac gcatctcacc gacgacccgg gccgctgggc ggccaccatc       540
     accattccgg tgatcaccct gacggtggcc agtatcgcca atgcgacggc gcaggtccgc       600
     ggcgccatgg tcgacgagct gagcaaggac tacatccgca ccctacgtac ccgcggaatc       660
     tcgtcccggt caatcctgct acgccacgcg ctacgaaacg cggcgggtcc cgcgctcacc       720
     gtgctgtccc tggaattcat cacgatgttc ggcggcgttc tcatcctcga gaacatcttc       780
     gccctgccgg gcttcggaac ctatgcgttc aacgcctccc tgcagggcga cgtcccgatc       840
     atcatgggag tcaccctgtt cgcggtgctg ctcatcgtca ccgtcaacct cgtcgtcgac       900
     ctcgtgaacg gatggctcaa cccgaaggcg agaatccatt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page