(data stored in ACNUC7421 zone)

EMBL: CP000820.PE447

CP000820.PE447       Location/Qualifiers
FT   CDS_pept        533380..534219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0452"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:bll0989 peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09916"
FT                   /db_xref="GOA:A8LGH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH7"
FT                   /protein_id="ABW09916.1"
FT                   /translation="MTSLLEVSELRVAYPRRGFRARPREVLHGVSLTIGAGETLGVVGE
FT                   SGSGKTTVGRAVLGLVRPDGGRILFQGRDVTYASAKERRALARTRQVVFQDPYSSLSPS
FT                   LTIGDILCEPLLVQGLPAREARAHVRALLDMVRLPKDALERLPREFSGGERQRVAIARA
FT                   LAPEPKLIVCDEPVSALDVSTQARVLDLFIDIQRRTGVAYLFISHDLAVIRHVSHRVSV
FT                   VYGGDIVETGPADVVTSTPEDPYTRRLLLAAPVADPIEQRRRRELRRHLAEQVSTPS"
     atgacctccc tgctcgaggt gagcgaactg cgcgtcgcct atccgcgccg cggcttccgc        60
     gcccgcccgc gtgaggtgtt acacggtgta tccttgacca tcggcgccgg cgaaactctc       120
     ggcgtcgtgg gtgaatccgg ctcgggcaag accacagtcg gccgcgccgt actcggcctg       180
     gtgaggccgg acggcgggcg gattcttttc cagggcaggg acgtcaccta cgcttccgcg       240
     aaggaacgcc gggcactcgc acgcacccga caagtggtgt tccaggatcc ctacagttcg       300
     ctcagcccgt cgctcacgat cggcgatatc ctctgcgagc cactcctggt ccaaggcctt       360
     ccagcgcgcg aggccagagc gcacgtacgc gcgctgctgg acatggtgcg actacccaag       420
     gacgcattgg aacgcctccc tcgcgaattc agcggcggcg agcggcagcg ggtcgcgatc       480
     gcccgcgcgc tggcccccga accaaaactg atcgtctgcg acgaaccggt ctccgcactc       540
     gacgtctcga cgcaggcgcg ggtgctggac ctgttcatcg acatccaacg ccgcaccgga       600
     gtggcgtatc tgttcatctc acacgacctc gcggtcatcc ggcacgtcag ccaccgggta       660
     agcgtggtct acggcggcga catcgtcgaa accggcccgg ccgacgtcgt gacctccaca       720
     ccggaagatc cttacacccg gcggctgctg ctcgccgccc cggtcgccga cccaatcgaa       780
     cagcggagac gccgggagct gcggcggcat ctcgctgaac aggtgagtac cccgtcatag       840
//

If you have problems or comments...

PBIL Back to PBIL home page