(data stored in ACNUC7421 zone)

EMBL: CP000820.PE449

CP000820.PE449       Location/Qualifiers
FT   CDS_pept        536845..537933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0454"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: rrs:RoseRS_3898 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09918"
FT                   /db_xref="GOA:A8LGH9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH9"
FT                   /protein_id="ABW09918.1"
FT                   /translation="MSFRWAIAGTGAIAHQFAAALGRLPDAELVAVGSRRQQTADAFGE
FT                   RFGIPRRRRYSSYERLAADDGVDVVYVASPHSHHHRHTLLFLSAGRGVLCEKPFALDAE
FT                   QAAEMVVAAQTHGQFLMEAMWSRFLPAYVKIRELVAAGAIGTVLAVEGDFGFPRPVDPA
FT                   NRVFDLAQGGGALLDLGVYPVSLASMLLGEPDRVVALGQLGETSVDEQVAVLMGYHTGA
FT                   VAVAKASLRASLACTGRVSGTEGSIELATFMHCPDNLTVRRKSGTQRLYLPADSDVTAT
FT                   DATATAGDIDGADRRNHRDRAAGGGLHHQIRHVHFRLQAGHLDSDIMSQAESVSVMRTL
FT                   DAARAQIGLRYLATLMDGSRQS"
     atgtcgttcc gctgggcgat cgcgggcacc ggcgccatcg cacaccagtt cgccgccgcg        60
     ctgggccgct tgcccgacgc cgagctcgtg gcggtcggct cccgccgcca gcagacggct       120
     gacgcgttcg gcgaacggtt cggcatcccg cgccggcgca ggtacagctc atacgagcgg       180
     ctcgccgccg acgacggtgt cgatgtcgtc tacgtggcct ccccgcactc ccaccatcac       240
     cgtcacaccc tgctgttcct gagcgcgggg cggggtgtgc tgtgcgagaa gccgttcgcg       300
     cttgacgccg agcaggccgc cgagatggtg gttgccgccc aaacccatgg gcagttcctg       360
     atggaagcca tgtggagccg cttcctgcct gcctacgtca agatccggga gttggtcgcc       420
     gcaggcgcca tcggcaccgt cctggccgtc gagggtgact tcggattccc ccgcccggtg       480
     gatcccgcca accgggtgtt cgatctcgcc cagggcggcg gcgcgctgct cgacctgggc       540
     gtctatccgg tgtcgctggc cagcatgctg ctgggcgaac ccgaccgggt ggtggcactc       600
     ggccagctcg gcgagaccag cgtcgacgag caggtcgccg tcctgatggg ctaccacacg       660
     ggcgcggtgg ctgtcgcgaa ggcatccctg cgcgcgagtc tcgcctgcac cggccgggtc       720
     tccggcacgg agggcagcat cgaactcgcc acgttcatgc actgcccgga caacctgacc       780
     gtccgacgga agtccggcac ccaacggcta tacctgcccg ctgacagtga cgtcactgcc       840
     accgacgcca ctgccaccgc cggtgatatc gacggtgccg accgccggaa ccatcgggac       900
     cgggcggccg gcggcgggct acatcaccaa atccgtcacg tgcacttccg gttacaggcc       960
     ggccacctcg acagcgacat catgtcccag gccgaatccg tgtcggtgat gcggacactc      1020
     gatgcagccc gggcccagat cggtctgcgc tacctggcca ccctgatgga tggtagccgg      1080
     cagagttga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page