(data stored in ACNUC7421 zone)

EMBL: CP000820.PE45

CP000820.PE45        Location/Qualifiers
FT   CDS_pept        complement(61226..61570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:pnf2850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09514"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB53"
FT                   /protein_id="ABW09514.1"
FT                   /translation="MIAEYMSVEHATLPVSDPEMTHQLLLTWLEHRRTSWPHTPNRHVL
FT                   VNERTALGTGPISPNYLHQHLLRHGVRLDRIRADRVLHEGGRRDTEERGNGLSGGGLLD
FT                   RGLPAGQRLW"
     ttgatcgcgg aatacatgtc agttgaacac gcgactctgc cggtctcgga ccccgagatg        60
     acgcaccagc tgctactgac ctggcttgag caccgccgca ccagctggcc acacaccccc       120
     aaccggcacg tcctggtcaa cgagagaacc gcgctgggaa ccggccccat cagtcccaac       180
     tacctgcacc agcacctgct tcgccacggc gtccgcctcg accgcatccg cgccgaccgc       240
     gtcctccacg aggggggccg ccgagatacg gaagaaaggg gcaacgggct cagcggcggc       300
     gggctgttgg atcgcggcct gccagcgggc cagcgccttt ggtga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page