(data stored in ACNUC7421 zone)

EMBL: CP000820.PE456

CP000820.PE456       Location/Qualifiers
FT   CDS_pept        complement(546324..547541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09925"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI6"
FT                   /protein_id="ABW09925.1"
FT                   /translation="MPLDELTRWLGAAAVAALTVAVTGCSVVGGGGDAPVAACESPGVT
FT                   ADKVHVGFVFSDSGSGSSALSSARAGVDARIGLANDAGGVNGRHIVYDWRDDAGSPSQN
FT                   ARVTEELVHDESVFGLISATAAGSGSLDSLSAMGIPVTGLANPTWAKYPNLFAYMYDVS
FT                   PVVTARYIQANGGTKAAFVMTGSPAFTVQTIERYKTAFAAIGVGTTETISYASGVDSPT
FT                   QAVERMVNSGANAIVAFTTPKDLVEILQTASAANLRFSSTVSVTGYDRGVLKTYGPQLA
FT                   GVSFTVNFHPFEMRNASMDRYRDAMTRFAPESSVPEQQFALYGYLYTDLFIRGLELAGE
FT                   CPTREGFIKSLRKVTDYDAGGLIEPVDLSTNRTQPLQCNAFVRINPDGTAFDIAGARLC
FT                   ADGTGA"
     atgcccttag atgaattgac aagatggctt ggagcggcgg cggttgctgc gcttacggtt        60
     gcggtgactg ggtgctcggt agtgggaggt ggaggggatg cgccagtggc cgcctgcgaa       120
     agccccgggg tcacggccga caaggtgcac gtcggtttcg tcttctccga ctcgggtagc       180
     gggagctccg cgctctcctc cgcccgtgcc ggggtcgatg ccaggatcgg cctggccaac       240
     gatgccgggg gggtgaacgg ccgccacatc gtttacgact ggcgcgacga tgccgggtcg       300
     ccgtcgcaga atgcccgcgt caccgaggaa ctggtccacg acgagtccgt ctttgggctc       360
     atatcggcca cagccgccgg cagcggctcg ctggacagcc tctcggccat ggggattccg       420
     gtaaccggcc tcgcgaaccc gacttgggcg aaatatccaa atctgtttgc atatatgtac       480
     gatgtctccc ccgtagtcac cgctcgttac atccaggcaa acggcggaac gaaagcggct       540
     ttcgtaatga ccgggtcgcc ggctttcacc gtacagacca tcgagcggta caagacggcc       600
     ttcgccgcta tcggtgtcgg cacaaccgaa accatctcct acgcgagcgg cgtcgacagt       660
     ccgacccagg cggtagaacg catggtgaac agtggtgcta acgccatcgt cgccttcaca       720
     actcccaagg acctcgtcga gatactgcag accgcgagtg ccgctaacct gcgtttctcc       780
     agcactgtct cggtcaccgg atacgaccgc ggcgttctta aaacttacgg accgcagctc       840
     gccggcgtct cgttcaccgt gaacttccac cccttcgaga tgcggaatgc ctccatggat       900
     cggtatcgcg acgccatgac gcgattcgct ccggagagca gcgtacccga acaacagttc       960
     gcactctacg gctatctgta caccgacctg ttcatccgcg gcctcgagct ggccggtgaa      1020
     tgccccacgc gcgagggatt catcaaatct ctgcgaaaag taactgacta cgatgcaggc      1080
     ggcctgatag aaccagtcga tctcagcacc aatagaactc agccgctcca atgtaacgca      1140
     ttcgttcgga tcaaccccga cggcaccgcc ttcgacatcg ctggtgcacg gctgtgcgct      1200
     gacggtacag gcgcctga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page