(data stored in ACNUC7421 zone)

EMBL: CP000820.PE457

CP000820.PE457       Location/Qualifiers
FT   CDS_pept        complement(548161..549108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0463"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   acr:Acry_1590 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09926"
FT                   /db_xref="GOA:A8LGI7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI7"
FT                   /protein_id="ABW09926.1"
FT                   /translation="MRAVRGHEGRPVVVDVDDVPGWDDGELLNMAVAGICASDLNWLRL
FT                   GTRFILGHELAGRKADGKPVLVEGLFGCGTCEFCWEGRNNLCDQSPRNALGIMQNGGMV
FT                   EQFRVPTRKVLEMPAGLDVSNASLAEPGAVAWHGVRLGGIAPGRTVTVVGGGSIGQLAA
FT                   AAAQTQGADEVVLEARYPHQHEIRERMGVGEPTAGTLYDVVIEAAGSPSSLQRSVELVK
FT                   PGGTVSLLGVHHGGIDVPYSALLTKEVTLVASMGYCGHAGKREMLQAAEMLAARPEIPD
FT                   SLITHRFPLEDAAEAFRVAGNRESGAVKVVIEIG"
     atgagggcag ttcgagggca cgaggggcga ccagtggtcg tcgatgttga cgatgttccg        60
     gggtgggacg acggtgagct gctgaatatg gccgtggctg ggatttgcgc ctcggacctc       120
     aattggctcc gactcgggac ccggtttatc ctcggccacg agctcgccgg gcggaaggca       180
     gatggaaagc ctgtgctggt ggaaggcctg ttcggctgcg ggacgtgcga attttgctgg       240
     gaaggccgga acaacctctg tgaccagtcc cctaggaacg cgctcggcat catgcagaac       300
     ggcggaatgg tggagcagtt tcgggtgcca acccgcaagg tccttgagat gccggcgggg       360
     ctcgacgttt cgaacgcgtc gctggccgag ccgggcgcag tggcctggca cggggtccgc       420
     ctcggtggga ttgcaccggg ccggaccgtc accgttgtcg gcggcgggtc gatcggtcaa       480
     cttgccgcgg ctgcggccca gacccagggc gctgatgagg tcgtgctcga ggctcgctat       540
     ccccaccagc acgaaatccg tgaacggatg ggtgtcgggg agcccacggc ggggacgctc       600
     tacgacgtgg tgatcgaggc cgccgggtcg ccgagttcac ttcagcgcag cgtcgagctg       660
     gtgaagccgg gtggcacggt ctcgctcctg ggcgtccatc acggcggcat cgacgtgccg       720
     tactcggcac tgctgaccaa ggaggtcacg ctggtcgcat caatggggta ctgcgggcac       780
     gccggtaagc gggagatgct tcaggccgcc gagatgctcg cggcgcgccc cgagatcccg       840
     gactcgctca tcacccaccg cttcccgctc gaggacgcag ccgaggcatt ccgggtggca       900
     ggcaaccgcg agtcgggcgc tgtcaaagtt gtcatcgaga tcggctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page