(data stored in ACNUC7421 zone)

EMBL: CP000820.PE464

CP000820.PE464       Location/Qualifiers
FT   CDS_pept        complement(556027..556842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09933"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ4"
FT                   /protein_id="ABW09933.1"
FT                   /translation="MVVSLGRRLEVTTTPLLPFTNWRFTPASSEQLRTAASKKAWGDSR
FT                   SIIGEFNGDQPSPWTAWIPEQPPPHSGPDTVTVAHALSAGFEPGRTFGVYPVSERNRIA
FT                   TRPGATLRKDARLPGGRLIEPATEPAWLTRLLTPDPHAFAPWEHPVDRVEASHDGAQLL
FT                   LSIRSARGETPATVQIQELSDRLDVLVSVGIEPGHGPLPVPGEFVPSSPIGSRPGRRAG
FT                   LIRLSPERLRLIRVTLTHPLGDRAVYDLAHQDQTARDTARRAWKDQWNS"
     gtggtggtaa gcctgggccg gagactcgag gtcaccacca ctccactact ccctttcacc        60
     aactggcggt tcacccccgc gagctcggaa cagctgagaa cagcggcctc gaagaaggct       120
     tggggtgact cccgctcgat catcggcgag ttcaacggcg atcaacccag tccctggacg       180
     gcgtggattc cggagcagcc cccgccgcac tcaggcccgg acacggtgac cgtggctcac       240
     gctctctccg ccggcttcga gccaggacgg acgttcggcg tctacccggt gtccgaacgg       300
     aacaggatcg cgacgcggcc aggcgcgaca ctccgcaagg atgcgcgcct accgggcgga       360
     aggctgatcg agccggcgac cgagcccgcc tggctcaccc ggctcctcac ccctgacccc       420
     cacgccttcg cgccgtggga gcatccagtc gaccgggtcg aggcgagcca cgacggagcc       480
     caactactac tctccatccg cagcgcgcgg ggcgaaaccc ccgccaccgt gcagatccag       540
     gaactatctg accgcctgga cgtgctggtg tcggtcggca tcgaacccgg ccacggaccg       600
     ctgccagtac ccggagagtt cgtcccgtcg tctcccatcg ggtcgagacc aggcaggcga       660
     gcggggctca tacgactttc ccccgaacga ctccggctaa tccgcgtgac tctgactcat       720
     cccctcggcg accgagccgt ctacgatctt gcacaccagg accaaactgc gcgagacacc       780
     gccagacgcg catggaaaga ccaatggaac agttga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page