(data stored in ACNUC7421 zone)

EMBL: CP000820.PE467

CP000820.PE467       Location/Qualifiers
FT   CDS_pept        complement(559194..560261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0474"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09936"
FT                   /db_xref="GOA:A8LGJ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ7"
FT                   /protein_id="ABW09936.1"
FT                   /translation="MSIRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPKTLRAHRLVTPGTVLRWHRRLITRKWTYPQRTGRPPVS
FT                   PEIAALIERLATENTTWGYQRIQGELLKLGHRVSASTIRRVLKSLGLPPAPKRQTDTTW
FT                   RQFLRTQASTMLAVDLFHVDCAVTLQRLYCFFVLEVGTRTVHILGVTAHPDGPWTTQQA
FT                   RNLLIDLGDRAADFQVLIRDRAGQLTASFDAALADAGITAVKIPPRTPRANAYAERFVH
FT                   TVRTEVTDRMLIVGERHLRTVLAEYARHYNGRRPHRGCGLQPPRPDHPVADLARERIKR
FT                   QPVLGGLINEYERAA"
     atgtccatcc gcctgctcta tctgatcttc gtgagggtgt gcggctggct ggtcctcctc        60
     ggccgttcgt cagcgtccaa ggacatcgag ttgctcgtgt tgcggcacga ggtcgcggtg       120
     ctgcgtcgta cccagcccaa gccccggtgg gactgggcgg accgggcggt cctcgccgca       180
     ctcatccgac tcctgcccaa gacgctgcga gcccaccggc tggtcacccc ggggaccgtc       240
     ctacggtggc accgccgtct gatcacacgg aaatggacct acccgcagcg gacgggacga       300
     cctccggtca gcccggagat cgccgcactg atcgagcggc tcgcgaccga gaacacgacg       360
     tgggggtacc agcggatcca gggcgagctc ctcaagctcg gccaccgggt cagcgcgtcc       420
     acgatccgcc gcgtcctgaa gtccctgggt ctcccaccgg cgcccaagcg gcagaccgac       480
     acgacatggc gacagttcct acgcacccag gcatcgacca tgctggccgt cgacctcttc       540
     cacgtcgact gcgccgtgac gctccagcgt ctgtactgct tcttcgtcct ggaagtcggc       600
     acccgcaccg tgcacatcct cggggtcacc gcccaccccg acggcccgtg gaccacccaa       660
     caagcccgga acctcctcat agacctcggc gaccgggccg ccgacttcca ggtcctgatc       720
     cgcgaccgcg ctgggcagct caccgcctcc ttcgacgcgg ccctcgccga tgccggcatc       780
     accgcggtca agatcccacc ccggactcct cgggcgaacg cctacgcgga acggttcgtc       840
     cacacggtcc ggaccgaggt caccgaccgc atgctgatcg tcggtgagcg gcacctgcgt       900
     accgttctgg ccgagtacgc acggcactac aacggacgac gaccccaccg cggttgtggc       960
     cttcaaccgc ctcggcccga ccaccctgtc gccgacctgg ccagggaacg gatcaagcgc      1020
     cagcccgtcc tcggcggcct gatcaacgaa tacgaacgag ccgcctaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page