(data stored in ACNUC7421 zone)

EMBL: CP000820.PE469

CP000820.PE469       Location/Qualifiers
FT   CDS_pept        562637..563221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09938"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ9"
FT                   /protein_id="ABW09938.1"
FT                   /translation="MPAEESATGMPRRAFLAAGLGIATVGATVALAKPAAAAGDGIHYW
FT                   RFCNKCFGLLRELRADNNHCPQGGSHVIQGWTFAVAYSNGNFLHAGETPSLQSAWMECY
FT                   YCALIYYGDANGVCVARGGAGHFGTSQQNLLPHDLNPIPGGYQSEWRFCFKCGTLYFDG
FT                   YRPNRGACPGNPGWGHAAAGYMFQLQVAAYT"
     atgccggcag aagaatccgc gaccgggatg ccacggcggg ccttcctggc cgcgggtctg        60
     ggcatagcga cggtcggcgc gacggtggca ctggcgaaac cggccgccgc ggctggggac       120
     gggatccact actggcgctt ctgtaacaaa tgcttcgggc tgctccgaga gctccgggcg       180
     gacaacaatc attgcccgca gggtggttct catgttatcc agggctggac gttcgctgtg       240
     gcgtattcga acggaaactt tctccacgcc ggcgagacgc cgtccctaca aagcgcctgg       300
     atggagtgct actactgtgc gctcatctac tacggcgacg ccaacggagt atgcgtcgcc       360
     cgaggcgggg cgggtcattt cggaacatcc cagcagaatc tcctccccca cgacctgaat       420
     ccgataccgg gcggctacca gtccgagtgg cggttctgtt tcaagtgcgg cacgctgtac       480
     ttcgacggtt accggccgaa ccgcggtgcc tgcccgggga acccgggctg gggacacgcc       540
     gcagccggtt acatgttcca gctccaggtg gctgcgtaca cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page