(data stored in ACNUC7421 zone)

EMBL: CP000820.PE47

CP000820.PE47        Location/Qualifiers
FT   CDS_pept        61929..62132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB55"
FT                   /protein_id="ABW09516.1"
FT                   /translation="MPTRAVEATSKTPKFRRGPPVAHCSRLSRIQGRSRSSEPGPPDSQ
FT                   RIRSSSSPADVLRRHRRRGTAA"
     ttgccgacca gggcggtcga ggcgacatcg aagacgccga agttccgccg ggggccgcca        60
     gttgcccact gttcgcggtt gtcgcggatc cagggcagga gccgctccag cgagccgggg       120
     ccgcctgaca gccagcggat caggtcatcg tcctcaccgg cagatgtgct gcggcgtcat       180
     cgtcggcgag gcaccgcagc atga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page