(data stored in ACNUC7421 zone)

EMBL: CP000820.PE471

CP000820.PE471       Location/Qualifiers
FT   CDS_pept        complement(563583..564650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0478"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09940"
FT                   /db_xref="GOA:A8LGK1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK1"
FT                   /protein_id="ABW09940.1"
FT                   /translation="MSVRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPRALRAHRLVTPGTVLRWHRRLITRKWTHPQRTGRPPIG
FT                   TEIATLIERLATENTTWGYQRIQGELLTLGHRVSASTIRRVLKTLGLPPAPKRQTDTTW
FT                   RQFLRTQASTMLAVDFFHVDCAVTLRRLHCFFVIEVDSRTVHILGVTAHPDGPWTTQQA
FT                   RNLLMDLGDQAADFQFLIRDRAGQFTASFDTVLADAGITAVTIPPRAPRANAYAERFVR
FT                   TVRTEVTDRMLIVGERHLRMVLAEYARHYNGRRPHRGRDLQPPRPDHPVADLTQERIKR
FT                   QPVLGGLINEYERAA"
     atgtccgtac gcctgctgta cctgatcttc gttcgggtct gtggctggct ggttcttctc        60
     ggccgttcgt cggcgtcgaa ggacatcgag ttgctggtgc tgcggcatga ggtcgcggtg       120
     ctgcgccgta cccagcccaa gccccggtgg gactgggcgg accgggcggt cctcgccgca       180
     ctcatccggc tcctgcccag ggcgctgcga gcgcaccggc tggtcacgcc cggcaccgtc       240
     ctacggtggc accgccgcct gatcacacgg aaatggaccc acccgcagcg gaccggacgg       300
     ccaccgatcg gcacggagat cgccacgctg atcgagcggc tcgcgaccga gaacacgaca       360
     tggggctacc agcgaatcca gggcgagctc ctcacactcg gccaccgggt gagcgcctcc       420
     acgatccgcc gggtcctgaa gaccctcggg ctgcccccgg caccgaaacg gcagaccgac       480
     acgacgtggc gacagttcct gcgtacacag gcatcgacca tgctggccgt cgacttcttc       540
     cacgtggact gcgccgtgac actccggcgt ctgcactgct tcttcgtcat agaggtcgac       600
     tcccgcaccg tccacatcct cggagtcacc gcccaccccg acggaccatg gaccacccaa       660
     caagcccgga acctcctcat ggacctcggt gatcaggcgg ccgacttcca gttcctgatc       720
     cgcgaccgcg ccggccagtt caccgcgtcg ttcgacacgg tcctcgccga cgccggcatc       780
     accgccgtca cgatcccacc ccgggctccc cgggcgaacg cctacgcgga acggttcgtc       840
     cgcaccgtcc ggaccgaggt caccgaccgc atgctgatcg tcggcgagcg gcatctgcgc       900
     atggtcctgg ccgagtacgc acggcactac aacggacgac gaccccaccg cggccgcgac       960
     cttcaaccac cccggcccga ccaccccgtc gcagacctga cccaggaacg gatcaagcgc      1020
     cagcccgtcc tcggtggctt gatcaacgaa tacgaacgag ccgcctaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page