(data stored in ACNUC7421 zone)

EMBL: CP000820.PE472

CP000820.PE472       Location/Qualifiers
FT   CDS_pept        complement(565191..565814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0479"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL1635
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09941"
FT                   /db_xref="GOA:A8LGK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK2"
FT                   /protein_id="ABW09941.1"
FT                   /translation="MTNQPTTGRGRRSRQKIVDAASALIDDRGVAGAGLDQILTAAGAS
FT                   KSQLYHYFGDKGGLVRAVVADRFDCLVEAQLPRLSQLDTWTAIRAWMDEFATQTAASDF
FT                   PGCPLGNLAGELAGRDEAIRADLSACFERWQAYLTQGLERMRIRGELVSDAEPELLALA
FT                   VFTSLQGGVLLARTHRDVLPLRVALDAAYAHLRSFAAPQPDVGR"
     gtgacgaacc aaccgacgac cggccggggc cggcgcagcc gccagaaaat cgtcgatgcg        60
     gcgtcggccc tgatcgacga ccgcggcgtg gccggggccg ggctagacca gatcctcacg       120
     gcggcggggg ccagcaagag ccagctctac cactacttcg gcgacaaggg cggactcgtc       180
     agggcggtcg tcgccgaccg gttcgactgc ctggtcgaag cacagctgcc tcggctctcg       240
     cagctcgaca cctggacggc gattcgcgct tggatggacg agttcgccac ccagaccgcg       300
     gcgagcgact tccccggctg cccgctcggc aacctggccg gcgagctggc cggtcgcgac       360
     gaagccatcc gcgccgacct ctcggcctgc ttcgagcgtt ggcaggccta cctgacgcaa       420
     ggcctggaac ggatgcggat ccgaggcgaa ctcgtgtccg acgcggagcc ggagctcctg       480
     gcgctcgcgg tcttcaccag tctgcagggc ggcgtcctcc tcgcccggac ccaccgggac       540
     gtcctgccgt tgcgcgtcgc gctcgacgcc gcctacgccc acctgcgctc gttcgccgcg       600
     ccccagcccg acgtcgggcg atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page