(data stored in ACNUC7421 zone)

EMBL: CP000820.PE473

CP000820.PE473       Location/Qualifiers
FT   CDS_pept        565947..566702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0480"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: psb:Psyr_4922 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09942"
FT                   /db_xref="GOA:A8LGK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK3"
FT                   /protein_id="ABW09942.1"
FT                   /translation="MSSLTGKPAALVTGGTTGIGLATAQMLHADGFDVLITGQNPETLA
FT                   AAAEQLPADVVVLRSDARTLSEPDRVAAAVRDRFGRLDVVFLNAGIGRLVPIEAVDEAT
FT                   YDEMFDVNVRSQLFTLQRVLPLLRDGGSVVFSTALGATLGLADWSVYSATKGALTALVH
FT                   ALAVELAPRGIRVNAVSAGPADTPALSKLGLPDAALATMRKDLAAAIPLGRLGVAQDVA
FT                   RAVAFLGSPAAGFVTGTTIAVDGGLGVAV"
     gtgtcatcgc tcactggaaa acccgccgcg ctggtgaccg gcggtaccac cggaataggt        60
     ctcgcgacgg cgcagatgct gcacgctgac gggttcgacg tgctcatcac cggccaaaat       120
     ccagaaacac ttgccgccgc tgccgaacag ttgcccgccg acgtggtcgt gctacgttcc       180
     gacgcccgca cactgtccga gccggatcgg gtggcggctg ccgttcggga tcgtttcggc       240
     cggctcgacg tagtattcct caacgcaggt atcggccggc tcgtcccgat cgaagcagtc       300
     gacgaggcga cgtacgacga aatgttcgac gtgaacgtca ggagtcagct gttcacgctg       360
     caacgggtcc tgcccctgct gcgagacggc ggctccgtcg tgttcagtac ggccctgggc       420
     gccacgctcg gtctggccga ctggtcggtg tacagcgcga cgaagggcgc gctgactgcc       480
     ctggtccacg ccttggccgt ggaactcgcg ccgcgaggaa tccgggtcaa cgcagtcagt       540
     gccggcccgg cggacacgcc cgcgctctcc aagctcggcc tgcccgacgc ggcgctggcc       600
     acaatgcgca aggacctggc cgccgcgatc cccctgggcc gcctgggcgt cgcccaggac       660
     gtcgcccgcg ccgtggcgtt cctcggctcc cccgcagccg gtttcgtcac cggcacgacg       720
     atcgcggtcg acggcggcct cggcgtggcg gtctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page