(data stored in ACNUC7421 zone)

EMBL: CP000820.PE475

CP000820.PE475       Location/Qualifiers
FT   CDS_pept        567588..568082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_4211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09944"
FT                   /db_xref="GOA:A8LGK5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK5"
FT                   /protein_id="ABW09944.1"
FT                   /translation="MDKAELDEQNRRVTAEFLTRGGVVSGDYQGMPLLLLHHVGARTGH
FT                   ARVNPMTYLAVNHSFAVFASNGGAAVHPDWYHNLLAHPTVSVVVGTETFPMVARVATGA
FT                   ERESIWARQKAVNPLFAELERATTRQIPVVILDRTPAPLPAPEPEPTPVPASSKDGDDR
FT                   R"
     atggacaagg ccgaactcga cgaacagaac cgtcgggtga cagcggaatt cctcacccgg        60
     ggcggcgtgg tcagcggcga ctaccagggc atgccgctgc tcctgctgca ccacgtcggc       120
     gccaggaccg gacatgctcg ggtcaacccg atgacctacc tggcggtcaa ccacagcttc       180
     gcggttttcg cgtccaacgg cggcgcggcc gtgcaccccg actggtacca caacctcctg       240
     gcccacccca cggtctcggt cgtcgtcggg acggagacgt tccccatggt ggcccgggtc       300
     gcgaccggag cggaacggga gagtatctgg gcccggcaga aggccgtcaa cccgctgttt       360
     gcagagctcg aacgggccac cacccgccag atcccggtcg tcatcctcga ccgcaccccg       420
     gctccgctgc cggcaccgga gccggagcct acgccggtgc cggcctcgag caaggacggg       480
     gacgaccggc ggtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page