(data stored in ACNUC7421 zone)

EMBL: CP000820.PE477

CP000820.PE477       Location/Qualifiers
FT   CDS_pept        569012..569251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09946"
FT                   /db_xref="GOA:A8LGK7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK7"
FT                   /protein_id="ABW09946.1"
FT                   /translation="MSAGRGLRRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKEVKL
FT                   FALRHQMAVLRWLWGARTWPLALTWSFRWLVRIR"
     ttgtctgccg gacggggtct gcgtcgggca ggctggatgg tcatggtgtg gtcgctgctc        60
     tacgccctga cacgcaacgc tctcgggctg atgttgctcc gggttcgtgg ggacaccgcg       120
     aaggaggtaa agctcttcgc cctgcgacat cagatggcgg tgttgcgatg gctgtggggt       180
     gccagaactt ggccactggc cttgacctgg tcttttaggt ggctcgttcg tattcgttga       240
//

If you have problems or comments...

PBIL Back to PBIL home page