(data stored in ACNUC7421 zone)

EMBL: CP000820.PE478

CP000820.PE478       Location/Qualifiers
FT   CDS_pept        complement(569226..570305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0485"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09947"
FT                   /db_xref="GOA:A8LGK8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK8"
FT                   /protein_id="ABW09947.1"
FT                   /translation="MMVHCVRTPAVSDLRAGLRLAGPPRSFVGVQGHRAAGVAARGHHA
FT                   APYPAQAPVGLGGPGGTRRTDPAFAEDTASAPTGHPRHRPTVAPPSNHTEMDLPAPDRT
FT                   TAGQHGDRDPHRAARDREHDVGIPADPGRAPHTRPPHWRVHDRRVLTSLGLPPAPKHQT
FT                   DTTWRQFLRTQASTMLAVDFFHVDCAVTLRRLYCFFVLEAGSRSVHILGVTAHPDGLWT
FT                   TQQIRNLLMDLGARTADFQFLIRDRAGQFTASFDAVLADAGITTVKIPPRTPRANAYAE
FT                   RFVHTVRTEVTDHMLIVGERHLRSVLAEYAAHYNGRRPHRSRDLQPPRPDHPIADLTKE
FT                   RIKRRPVLDGLINEYERAT"
     atgatggtcc actgtgtccg tacgcctgct gtatctgatc ttcgtgcggg tctgcggctg        60
     gctggtcctc ctcggtcgtt cgtcggcgtc caaggacatc gagctgctgg tgttgcggca       120
     cgaggtcacc atgctgcgcc gtacccagcc caagccccgg tgggactggg cggaccgggc       180
     ggtactcgcc gcactgatcc agcttttgcc gaagacactg cgagcgcacc gactggccac       240
     ccccggcacc gtcctacggt ggcaccgccg tctaatcaca cggaaatgga cctacccgca       300
     ccggacagga cgaccgccgg tcagcacgga gatcgcgacc ctcatcgagc ggctcgcgac       360
     cgagaacacg acgtggggat accagcggac ccagggcgag ctcctcacac tcggccaccg       420
     cattggcgcg tccacgatcg ccgggtcctg acgtccctgg ggctgccccc ggcaccgaaa       480
     caccagaccg acacgacgtg gcggcagttc ctgcgcaccc aggcatcgac gatgctggcg       540
     gtcgacttct tccacgtgga ctgcgccgtg acgctgcggc gtctgtactg cttcttcgtc       600
     ctggaagccg gctcccgctc cgtccacatc ctcggggtca ccgcccaccc ggacgggctg       660
     tggaccaccc aacagatccg caacctcctc atggacctcg gcgcccggac agccgacttc       720
     cagttcctga tccgcgaccg cgccgggcag ttcaccgcgt ccttcgacgc ggtcctcgcc       780
     gacgccggca tcaccaccgt caagatccca ccccggacgc cccgggcgaa cgcctacgcc       840
     gaacggttcg tccacacagt ccggaccgag gtcaccgacc acatgctgat cgtcggtgaa       900
     cggcacctac gttctgtcct ggccgagtac gccgcccact acaacggacg acgaccccac       960
     cgcagccgcg accttcaacc accacgaccc gaccacccca tcgccgacct gaccaaggaa      1020
     cggatcaagc gccgccccgt cctcgacggc ctgatcaacg aatacgaacg agccacctaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page