(data stored in ACNUC7421 zone)

EMBL: CP000820.PE480

CP000820.PE480       Location/Qualifiers
FT   CDS_pept        570804..571682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0487"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: sma:SAV7484
FT                   N5,N10-methylenetetrahydromethanopterin reductase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09949"
FT                   /db_xref="GOA:A8LGL0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGL0"
FT                   /protein_id="ABW09949.1"
FT                   /translation="MSDSMVRGMDIGIFTGITDEQIRPALLARAVEERGFESLFVAEHT
FT                   HIPVRRETPYPEGGDLPRDYYRTLDPFISLTTAAAVTTRLRLGTAIALVVQRDPILLAK
FT                   ETATLDLVSDGRFELGIGAGWLREEMRNHGTDPETRVPLMRERLAATKALWTSEQAEFH
FT                   GRFVDFDPIFQWPKPVQRPHPPVWIGGWGPTTFHRIVTDGDGWLAPPIPVDALARGVEE
FT                   LAEVANRAGTAAPPVTAILLNPDEAATEKAALLGVRRILFGLFPVTDADTTLRTLDHLG
FT                   TLAQRTVLARG"
     atgtcagact ctatggtacg aggcatggat atagggatct tcaccggtat caccgacgag        60
     cagatcaggc cggccctgct cgcacgggca gtcgaggagc gggggttcga gtcactgttc       120
     gtcgccgagc acacccacat cccggtccgc cgggagacgc cgtatcccga aggtggcgac       180
     cttccccgcg actactatcg caccctcgat cccttcataa gcctgacgac cgccgcggcc       240
     gtgacgaccc gattgcgact cggcaccgcg atagcgctgg tggtacagcg ggatccgatc       300
     ctgttggcga aggagaccgc caccctcgac ctggtcagcg acggccgatt cgagctgggc       360
     atcggcgccg gctggctgcg cgaggagatg cgcaaccacg gcaccgaccc ggaaacccgg       420
     gtgccgctga tgcgggaacg gctggccgcg acgaaagcgc tctggacgtc ggagcaggcg       480
     gagttccacg gtcgcttcgt cgacttcgat ccgatcttcc aatggccgaa accggtgcag       540
     cggccgcatc caccggtgtg gatcggaggc tggggtccga ccacattcca ccggatcgtc       600
     accgacggcg acggctggct cgctcctccc ataccggtcg acgccttggc ccgcggggtc       660
     gaggaactag ccgaggtggc gaaccgggcc gggacggccg caccaccggt gaccgcgatc       720
     ctgctgaacc ctgacgaggc agcgaccgag aaagctgcgc tcctcggtgt ccgtcgcatc       780
     ctgttcgggc tgtttcccgt caccgatgcc gacacgacac tgcgcactct ggaccacctg       840
     ggcaccctgg cccagcgcac ggtcctggct cggggctaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page