(data stored in ACNUC7421 zone)

EMBL: CP000820.PE489

CP000820.PE489       Location/Qualifiers
FT   CDS_pept        complement(578590..579471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09958"
FT                   /db_xref="GOA:A8KX55"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX55"
FT                   /protein_id="ABW09958.1"
FT                   /translation="MSTHRPRRIGRGEAERMLRGGPVNDGVGADPLADLLAAVAAPARD
FT                   GELDGEEAAVAAFREARLTHVTQPRRKPMIKMMFAKLLTVKVAALAAGATAIGGVAVAA
FT                   STGVLPIAGGGDSAAVSPTASPSAEVSVPAIHVPSAGASVSVSLLGLCHTYTAAAATDA
FT                   RTTLDSPNMRALVTAAGSPDKVDAFCAKALQAEIDAAATPGTTPGASASAGPDGNGVGA
FT                   QVPGAGAGVGASAGPDGAGLGVHVGPSAGVGASARPGGAGVGAQVPSAGVGANVGQGGA
FT                   GLGASAAPSVHR"
     atgagcacac accgaccccg tcggatcggc cggggcgagg cagaacggat gcttcgcggc        60
     ggcccggtca acgacggggt cggtgcggat ccccttgccg acctgctcgc cgccgtggcc       120
     gctccggccc gcgatggcga acttgacggt gaggaagcgg ccgtggccgc tttccgggag       180
     gcgcgtctca cccacgtcac ccagccgcgg agaaaaccca tgatcaagat gatgttcgca       240
     aagctcctga ccgtgaaggt cgccgccctg gcggccgggg ccacggctat cggtggcgtc       300
     gccgtcgctg ccagcacagg agtactcccg atcgccggtg gaggtgacag cgccgctgtg       360
     tccccgacgg cctcgccctc cgccgaggtg agcgtcccgg cgatccacgt gccgagcgcc       420
     ggcgcgtccg tctcggtgtc actgctcggc ttgtgccaca cctacacagc cgccgcagcg       480
     accgacgccc gcacgactct cgattccccg aacatgcgcg cgctcgtcac tgccgccggc       540
     agccctgaca aggtcgacgc cttctgcgcg aaggcactac aggcggagat cgacgctgcc       600
     gcgacaccgg gcaccacccc cggcgcaagt gcaagtgcgg ggccggacgg taatggtgtc       660
     ggcgcgcagg ttccgggtgc gggtgcgggg gtgggcgcga gtgcggggcc ggatggtgcg       720
     ggtcttggcg tccatgtggg gccgagcgca ggagtgggtg cgagtgcgag gccgggcggt       780
     gctggtgtcg gcgcgcaggt cccgagcgcg ggggtgggcg caaacgtcgg ccagggcggc       840
     gccggactcg gtgccagcgc ggccccgtca gtgcatcgct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page