(data stored in ACNUC7421 zone)

EMBL: CP000820.PE490

CP000820.PE490       Location/Qualifiers
FT   CDS_pept        complement(579529..580140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0498"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: fal:FRAAL0432 putative RNA
FT                   polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09959"
FT                   /db_xref="GOA:A8KX56"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX56"
FT                   /protein_id="ABW09959.1"
FT                   /translation="MIEELDLSSAVIEAQCGDEVAFRLIYRMIQPGLLRYLRVLVGDDA
FT                   EDVASEAWLQIARDLASFRGDFDGFRGWAATIARHRALDHLRRRTRRQRDDIPVEMVTT
FT                   ELAAPDDTAGGALEAMSTEAAMRLIAGLPLDQAEAVLLRVVMGLDAKTAGRVLGKRAGA
FT                   VRTAAHRGLRRLAAQLAEQGITEAGRPEAGEHDRGDSTRR"
     ttgatcgagg aactggatct ctcctcggca gtgatcgaag cgcagtgcgg tgacgaggtg        60
     gccttcaggc tgatctaccg gatgatccag ccgggtctgc tgcggtacct gcgggtactc       120
     gtcggcgacg acgccgagga tgtggcgtcc gaggcgtggc tgcagatagc ccgggacctg       180
     gcatcgttcc gcggggactt cgacgggttt cgtggctggg cagccacgat cgcgcgtcac       240
     cgcgcgctcg accacctgcg ccgacgcact cgccgtcagc gagacgacat accggtcgag       300
     atggtgacga cagaactggc cgcgcccgac gacaccgccg gaggggcgtt ggaggcgatg       360
     tccaccgagg ccgctatgcg cctgatcgca ggtctgccgt tggaccaggc ggaggcggtg       420
     ctcctgcggg tagtcatggg gctggacgca aaaaccgcgg ggcgggtcct gggcaagcgc       480
     gccggcgcag tccgcaccgc ggcacataga gggttgcgcc ggctcgccgc acagctcgcc       540
     gagcagggaa tcaccgaagc cggtcgaccg gaggcaggtg aacatgatcg gggtgacagc       600
     acacgacgat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page