(data stored in ACNUC7421 zone)

EMBL: CP000820.PE492

CP000820.PE492       Location/Qualifiers
FT   CDS_pept        581191..581571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09961"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX58"
FT                   /protein_id="ABW09961.1"
FT                   /translation="MTTITVRNLDRSDERRDFPHGHIDVLAVGGHRLDRAVFEPGWRWS
FT                   ESVKPIAGTDLCEFDHFGYVASGRMHLEMADGTGADIGPGDVVACPPGHDAWVLGDEPC
FT                   VFVEMAEPVASDYARAPGTGQP"
     atgacgacga tcacggttcg caacctcgac aggtccgacg aacggcgcga tttcccccac        60
     ggccatatcg acgtcctcgc cgtcggcggc cacaggcttg accgggcggt gttcgagccg       120
     ggctggcggt ggtcagagtc ggtgaaaccg atcgcgggga ccgatctgtg cgagttcgac       180
     cacttcggct acgtagcctc gggccggatg cacctcgaga tggctgacgg cactggtgcg       240
     gacatcggcc ccggcgacgt ggtggcctgc ccgcccggcc acgacgcctg ggtgttgggc       300
     gacgagccct gcgtgttcgt cgagatggca gagccggtcg cctccgacta cgcccgcgcg       360
     ccgggcaccg ggcagccgta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page