(data stored in ACNUC7421 zone)

EMBL: CP000820.PE493

CP000820.PE493       Location/Qualifiers
FT   CDS_pept        582101..582856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09962"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX59"
FT                   /protein_id="ABW09962.1"
FT                   /translation="MGASAPPASPTEFRRPTARNRLVGLLAWLAATIAVAAVTARLAAP
FT                   DIASTGAAGLTSDIAETTLADRATVVLAQRRIEPVLSLDGRVVPSDPASDGGFDIVAPV
FT                   RPEDVAYRLIDPPRRIRAAVVGGPSGFDCEYQSLAADSGATEAGATAAAGTSVRCRIPA
FT                   SIRVVPGLSATIGIAWSEPRVTSVLPLTAVLGAAQQGQVVVVDAAGSHTSVRTVALGAS
FT                   DATWIEVSSGLAAGERVLARPVQSDLADD"
     gtgggggcct cagctcctcc tgccagcccg acggagttcc gccggcccac agcgcggaac        60
     aggcttgtcg gcctgctggc ctggctcgcc gcgaccatcg cggtcgctgc agtcaccgct       120
     cgtctcgccg cacccgacat tgcttcgact ggtgccgccg gtctgacctc cgacatcgct       180
     gagaccaccc tggcggaccg cgcgacagtc gttctcgcgc agcgccgcat cgagccggtg       240
     ctctccctgg atggcagggt cgttccgagc gacccggcca gcgacggggg gttcgatatc       300
     gttgcgccgg ttcggcccga agacgtcgcc taccgcctga tcgatccacc acgacgcatc       360
     cgagccgctg ttgtcggcgg gccgagcgga tttgactgcg aatatcagtc gctggccgcc       420
     gacagcggtg ccaccgaggc cggcgccacg gccgcggccg gcacaagtgt ccgatgccgg       480
     attccggcct cgatccgcgt tgttccggga ctgtccgcca ccatcgggat agcgtggagt       540
     gagccgcgtg tcacctccgt cctgccactg accgctgttc tcggagctgc gcagcagggg       600
     caggtggtgg tcgtcgacgc cgccggctcg cacacatccg ttcgcacggt ggctctcggg       660
     gccagcgatg cgacctggat cgaggtcagc agcgggctcg cggccggcga aagggtactc       720
     gcgagaccgg tccagagcga ccttgccgat gactga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page