(data stored in ACNUC7421 zone)

EMBL: CP000820.PE495

CP000820.PE495       Location/Qualifiers
FT   CDS_pept        583538..585370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0503"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cmi:CMM_2031 putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09964"
FT                   /db_xref="GOA:A8KX61"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX61"
FT                   /protein_id="ABW09964.1"
FT                   /translation="MRRRHTTAGARNGMLPIFGLGIAAWYDVRTRPLRTLAAVAGMIAA
FT                   VGALMVVDAAGVLSRHGADDYLRRQYGQPATFLISGTGSSDARRQTEADTLLTQGLDQA
FT                   GFRTISPYQLVRGITLDGDHSAAVDTAVVDGSYPDVRVIDLVAGDFPTRAADRGVPRAV
FT                   LEEGIARQLGWEPHQIVGRQLQYAVTGTAATIDTRNPRTMTVVVDAVMASTARGDSVPR
FT                   LLLVGRLPPQLHSAAEDTPGRWLARVAPADTAYFQEVVASTGRRLGSGSGFEATRLDQD
FT                   EALAPVIDQQTRTAGIVAWVAMAVGGLGMLGVGVASVRERARELGVRRALGASRATIFL
FT                   GVLVETMFNVLVAAALAVPLAALIVHLLPLPVQHGHRHIALRRRPARIGHRSAPGPLER
FT                   HHPAGRQHRRRRPSHPCLHARSRRDGGRSPRHRAGSCRPPGPDRGPERTRAGRVVAEPE
FT                   PLGHRRGGLAAHGDGAAPSVHQRACRLADHPGARRCGRCRYLYRTTVVLPAGWDTGVGA
FT                   VLLELGQVAGTMRVSVNGRSAGDDCVATRALDVRPLLRDGANHVEMEIATTLGNRLIGL
FT                   GKAGEEAYARFAKRSPRPAGLIGPVSLSGIAATT"
     gtgaggcgac ggcacacaac ggccggggcc cgcaacggta tgctgccgat attcggcctc        60
     ggcatcgcgg cctggtacga cgtacggacc aggccgttgc gaacgctggc cgcggtcgct       120
     gggatgatcg ccgcggtcgg cgcactgatg gtggtagacg cggctggggt cctttcccga       180
     cacggcgcgg acgactatct gcgccgccag tacggtcaac ccgcgacttt tctgatctcc       240
     ggtaccggct cctccgatgc gcgacggcaa accgaggccg acaccctgct cacccagggg       300
     cttgaccagg cgggattcag aacgatcagc ccctaccagc tggttcgtgg gatcacgctc       360
     gacggcgacc attcggcggc cgtcgacacg gcggtcgtcg acggctccta cccggatgtc       420
     agagtcatcg atctcgtcgc gggggacttc cccacccggg cagctgacag aggtgttccc       480
     cgcgccgtcc tcgaggaggg gatcgcgcgc cagctcggct gggagcctca ccagatcgtc       540
     ggacgacagc tccagtacgc ggtgaccgga acagccgcca ccatcgacac ccggaacccg       600
     cgaacgatga cggtcgtcgt ggacgcggtc atggcctcca cggcacgcgg cgattccgtc       660
     ccacggctcc tccttgtcgg tcgcctgccc ccacagctgc actcggcggc ggaagacacc       720
     ccaggtagat ggctggcccg ggtggcacct gccgataccg cctacttcca ggaagtcgtg       780
     gcgagcacgg ggcgacggct cggatcggga agcggcttcg aggccaccag gctggatcag       840
     gacgaggctc tggcacccgt catcgatcag cagacccgga ccgccggcat cgtcgcctgg       900
     gtggcgatgg ccgtcggtgg cctcggcatg ctcggtgtcg gcgtcgcctc cgtccgggaa       960
     cgtgctcgtg aactcggcgt gcgccgagcg ctcggcgcat cccgcgcaac catcttcctg      1020
     ggcgttctcg tcgagacaat gttcaacgtg ctggtagcgg ccgcactcgc cgtgccactg      1080
     gccgccctga tcgtccactt gctgccacta cctgttcaac atgggcaccg ccacatcgcg      1140
     cttcgtcgtc gacctgcgcg gatcgggcac cgctcggctc ctggacctct ggaacggcac      1200
     cacccagccg gtcgccagca ccgtcgacgg cgaccgtcac acccttgcct tcacgctcgg      1260
     tcccggcggg acggcggtcg ttcacctcgg caccgggccg ggtcttgccg cccgcccggt      1320
     ccagaccgag gccccgagcg aacccgcgca ggtcgtgtgg tcgcagaacc tgaaccgctg      1380
     ggacatcgac gtggcggact ggcggcccac ggggacggtg cggcaccgtc agtccatcag      1440
     cgcgcctgcc gactggcgga ccatcccggc gctcgccgat gcggccggtg tcggtacctc      1500
     taccgcacga cggtggttct gccagccggt tgggacaccg gcgtcggcgc ggtgctgctg      1560
     gagctgggcc aggtcgcggg gacgatgcgg gtgagtgtca acgggcggag cgcgggcgat      1620
     gactgcgtcg cgacccgagc gctggacgtg cgtccgctcc tacgggatgg cgccaaccac      1680
     gttgagatgg agatcgccac gaccctggga aaccgcctga tcggactcgg taaggcgggc      1740
     gaggaggcct acgcgcggtt cgccaaacgg tcgccccgac cggcgggcct catcgggccc      1800
     gtgtcactga gtgggatcgc cgccacgacg tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page