(data stored in ACNUC7421 zone)

EMBL: CP000820.PE496

CP000820.PE496       Location/Qualifiers
FT   CDS_pept        complement(585420..585989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0504"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   sen:SACE_3089 SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09965"
FT                   /db_xref="GOA:A8KX62"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX62"
FT                   /protein_id="ABW09965.1"
FT                   /translation="MMPPEFGATPWGRAWVRTVESTSTAGPNAQLPKARTLARNSTTVV
FT                   AAGAGHVEADVTVSGEVCRVRLDLPVWSDETQAEAGRLVAKAMAEHRGMVAGDLPDTLE
FT                   EDLRDHAINIAVPLEEQPGSCSCRARKRPCVHILAVIYALAQLVDERPALAVELRSATA
FT                   NAAGAGAGAVDWIALSELEPAGFYGD"
     atgatgccgc cggagttcgg tgccacgccg tggggcaggg cctgggtccg cacggtcgag        60
     tcgacgtcga cggccgggcc caacgcgcag ctgcccaagg cgcggacgct cgcacggaac       120
     agcaccaccg tggtggctgc cggggccggg catgtcgagg ccgacgtcac cgtctccggc       180
     gaggtgtgcc gggtccggct cgacctgccg gtctggtccg acgagacgca ggccgaggcc       240
     gggcgcctgg ttgccaaagc catggccgag caccgcggca tggtcgccgg agacctgccc       300
     gacaccctcg aggaagacct cagagaccac gcgatcaaca tcgccgtccc cctggaggag       360
     cagcccggca gctgcagctg ccgggctcgc aaacgaccat gcgtgcatat cctcgccgtg       420
     atctacgcgc tggcccaact cgttgacgag cgtccggcac tggcagtcga gctgagatcc       480
     gctaccgcga atgccgccgg tgccggtgcc ggtgccgtgg actggatcgc gctgtccgaa       540
     ctcgagcccg ccggcttcta tggagactga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page