(data stored in ACNUC7421 zone)

EMBL: CP000820.PE498

CP000820.PE498       Location/Qualifiers
FT   CDS_pept        complement(588041..588454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09967"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX64"
FT                   /protein_id="ABW09967.1"
FT                   /translation="MSCSVLAGVRRAADEAHANEAFGLRRPMRRPDCQASGIRPAPDVL
FT                   LALGCRPGVPSLPEPCALLGLTHAARYTTLGGAPANRKRALETKRRRLSSSWAMCISAA
FT                   APRWLFDMGGRSQTRLESGLVNGSRAAQALVMS"
     gtgtcgtgct cggtcctggc aggtgtccgc cgggcagcgg acgaggccca cgccaacgaa        60
     gccttcggcc tgaggcggcc gatgcgccgg cccgactgtc aggccagcgg gattcgcccg       120
     gcgcctgacg tcctcctcgc cctcgggtgc cgtcccgggg ttccgtctct gccggaaccg       180
     tgtgccctgc tcggactgac gcatgccgcc cgctacacga cgctgggagg tgctccggcg       240
     aataggaagc gcgccttaga aacgaaaagg cggcgactgt caagctcctg ggctatgtgt       300
     attagcgcgg ccgcgccgcg ctggctcttc gacatgggcg gacggtctca gacccgacta       360
     gagtccggcc tggtcaacgg gtccagggcc gctcaagccc ttgtgatgag ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page