(data stored in ACNUC7421 zone)

EMBL: CP000820.PE500

CP000820.PE500       Location/Qualifiers
FT   CDS_pept        complement(589386..591407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0508"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: fal:FRAAL2289 putative two-component sensor
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09969"
FT                   /db_xref="GOA:A8KX66"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX66"
FT                   /protein_id="ABW09969.1"
FT                   /translation="MTSVSGDARHVGAGSWAGEHVGDVEAAVLLDTLSEVVFRTDAEGR
FT                   WTYLNRAWTRLTGFEIGPSLGARFLDYVHPDELEYTVALFMGVVAGGADHCHHETRYRT
FT                   RDGSYRRVQIRANVIRDGDGEVIGNTGTIVDVTDSRRGSETIGEHVALLELVSADAPGG
FT                   ELPVGVVVYDADLRLRRGSPVIDRLAGAPQRIGDPLARLVERLAPADPRQRALGGEWGL
FT                   IAVARRTNHAQVSDLDLADPSRSLRVSVIPYLRDGEEMLALVLADITDLRRAEHRQAAL
FT                   ARLGHRAISSSDTAALVSEAAGMVTSTLDVAGCKLIHLDPRGGDAAGTSPLLDRVLTDD
FT                   QPVMIDSPVSDLARCLAGSPPGSDVATVLATRVGGAGLLFGVLAAHSTTPRHFTDDEIQ
FT                   FVQAVADILTAALERDRTDHELRRLYRRAEHSKAWLAASAHTITRVIAATEPRDALDLI
FT                   AATARTMAGTDIGVVAVPDEHGNLVITTADVAPGLPAAPDSLLGLSLTQGVTPVAEQLT
FT                   AGGTVVLDSLDLRGSRISPAPNMPIATALILPLRITRRSSAVLILGNHTDTARLPLHDI
FT                   ELIEAFAHDAALAVELIQTQHDRARLAVFQDRDRIARDLHDQVIQRLFAIGLHLQSLTR
FT                   AVGDIAAARLTSAINALDHTIDDIRHTIFDLHPIQPGQ"
     atgacatcag tatcaggtga tgcccggcac gtcggcgcgg ggagctgggc cggtgaacat        60
     gtcggtgatg ttgaggccgc ggtgctgctc gacacgttga gcgaggtggt gttccgcacc       120
     gacgcggaag gccgctggac gtatctcaac cgggcgtgga cgaggctgac cggcttcgag       180
     atcggcccca gtctcggtgc ccgattcctg gactacgtcc atcccgacga actggagtac       240
     acggtcgccc tgttcatggg ggtggtcgcc ggtggcgccg accactgcca ccacgagacc       300
     cggtaccgca cccgtgacgg cagctaccgc cgcgtgcaga tcagggcgaa cgtgatccgg       360
     gacggggacg gcgaggtgat cggtaacacc gggacgatcg tggatgtcac tgactcccgt       420
     cgcggcagcg agacgatcgg ggaacacgtc gccctgctcg aactcgtctc ggcggacgca       480
     ccgggcggcg agctgccggt gggggtggtc gtgtacgacg ctgacctgcg gctacggcga       540
     ggctcaccgg tcatcgatcg gctggccggc gcaccgcagc gcatcggtga ccccctcgcc       600
     cggctcgtgg agcgcctggc gccggccgac ccgagacaac gcgccctggg cggcgaatgg       660
     gggctgatcg cggtcgcgag acgcaccaac cacgcccagg tcagcgacct cgaccttgcc       720
     gatcccagcc ggtcgctacg ggtatcggta atcccctatc tgcgggacgg ggaggagatg       780
     ctcgcgctcg tcctggccga catcaccgac ctgcgtcgcg ccgaacatcg ccaagcagcc       840
     ctggcccggc tcggccaccg ggccatctcc agctccgaca ccgccgcgct ggtgagtgaa       900
     gccgccggga tggtcacctc gacactcgac gtcgccggct gcaagctgat ccacctcgac       960
     ccgcgaggcg gcgacgcagc cggcacgagc ccgctgcttg accgggtcct gaccgacgac      1020
     cagccggtga tgatcgacag tccggtcagc gacctggctc gctgcctggc gggatccccg      1080
     ccaggcagcg atgtcgccac cgtgctcgcc acgcgcgtcg gcggcgcagg gctactgttc      1140
     ggtgtcctcg ccgcccacag cacgaccccg cgtcacttca ccgacgacga gatccagttc      1200
     gtccaagcag tggccgacat cctcaccgca gccctcgaac gcgaccgcac cgaccacgaa      1260
     ctgcgcagac tctaccggcg ggcggaacac agcaaagcgt ggctggcagc gagcgcgcac      1320
     accatcaccc gggtcatcgc cgccaccgag ccgcgcgacg ccctcgacct gatcgcagcc      1380
     acggcgagaa cgatggcggg caccgacatc ggggtggttg ccgtgcccga cgagcacggc      1440
     aacctggtga taaccacagc cgacgtcgcc cccggcctgc cagctgctcc tgattccctg      1500
     ctcgggctga gcctcacaca gggcgtgacc ccggtggccg agcagctcac ggccggtggc      1560
     accgtcgtcc tcgacagcct cgatctacgt ggcagcagga tctccccggc gcccaacatg      1620
     cccatcgcca ccgcactgat cctcccgcta cggatcacgc ggcgatcatc ggccgtgctc      1680
     atcctcggaa accacacgga cacagcacgc ctcccgctcc acgacatcga gctgatcgag      1740
     gcgttcgccc acgacgccgc gctcgccgtc gaactcatcc agacccaaca cgaccgggcc      1800
     cgcctcgccg tcttccagga ccgcgaccgc atcgcccgcg atctgcacga ccaggtcatc      1860
     caacgcctct tcgcgatcgg cctgcacctg cagtccctga cccgagccgt cggcgacatc      1920
     gcagcagccc gactgaccag cgccatcaac gccctcgacc acaccatcga cgacatccgc      1980
     cacacgatct tcgacctgca ccccatacag ccaggccaat ag                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page