(data stored in ACNUC7421 zone)

EMBL: CP000820.PE503

CP000820.PE503       Location/Qualifiers
FT   CDS_pept        complement(597383..597967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0511"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mkm:Mkms_5540
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09972"
FT                   /db_xref="GOA:A8KX69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX69"
FT                   /protein_id="ABW09972.1"
FT                   /translation="MARDTRERLLDAGLALFAGNGLAGTTVSGLEARAGLRAGSGSFYR
FT                   HFASKEALFEAVIRRELDRFRASISDAAPGESAIADVKVTLALEFHQALTTLDQLGGLE
FT                   AIISRDARAMGDLFDEVEGLFNAALDASTARLDQLMESGQIPRRDPQALAATIRSALVG
FT                   YHLNTQSFRRSARRVPPADLIATLIDLISSK"
     atggcccggg atacccgcga gcgcctgctg gacgcgggac tcgccctgtt cgccggcaac        60
     ggcctcgccg gcaccacggt ctccggtcta gaagcccgtg ccgggctccg ggccggatct       120
     ggctcgttct accgccactt cgcctcgaaa gaggcgctat tcgaggccgt catccgacgg       180
     gaactcgacc ggttccgcgc ctcgatcagc gacgcggcgc ccggcgagtc ggccatcgcg       240
     gatgtgaagg tcacactcgc gctggagttc caccaggccc tgacgacact ggaccagctc       300
     ggcggacttg aggcgatcat cagccgggac gcccgcgcga tgggcgatct ctttgacgag       360
     gtggaaggcc tgttcaacgc cgccctcgac gccagcaccg cccggctgga ccagctgatg       420
     gagtccggac agatcccccg gcgcgacccc caggccctcg ctgcaacgat caggagcgcg       480
     ctcgtcggat atcacctgaa cacgcagtcg ttcagaaggt ccgctcgccg cgtgccaccg       540
     gcggatctga tcgccacgct gatagacctg atctcctcca aatga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page