(data stored in ACNUC7421 zone)

EMBL: CP000820.PE505

CP000820.PE505       Location/Qualifiers
FT   CDS_pept        598589..599428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0513"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: msm:MSMEG_0291 dioxygenase, TauD/TfdA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09974"
FT                   /db_xref="GOA:A8KX71"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX71"
FT                   /protein_id="ABW09974.1"
FT                   /translation="MAIEVTRLAPEIGAEISGYTGRDLVNEAAAAACKAALDRYGVLVY
FT                   REVHIEDGDLVRFSRLLGEVVVPKVNDPGEHPEIARITLDPEKSVLAGYRQGNFLWHID
FT                   GATDELPQKATLLTAREVDPAGGDTEFANTYAAYEALSDEEKAEIADLQVVHSFAIAQR
FT                   IAYPDAADKQRASWEKVPTRVHPLVWTRANGRKSLLIGATAGMVVGRSEDRGRTLLDRL
FT                   LQWSTSPRFTLRHQWRRGDLVIWDNTGVLHRALPFEPTSRRLMHRTTLVGQELVTAR"
     atggccatcg aggtcaccag gctggcaccc gagatcggtg ccgagatcag cggctacacg        60
     ggacgcgatc ttgtcaacga ggcggcggct gccgcctgca aggctgctct ggaccggtac       120
     ggcgtcctgg tgtaccggga ggttcatatc gaggacggcg acctggtccg gttcagccgg       180
     ctgctgggag aggtggtggt gcccaaggtc aacgaccccg gcgaacaccc tgagatcgcc       240
     cggatcacgc tcgaccccga gaagagcgtg ctggccggct atcggcaggg gaacttcctc       300
     tggcacatcg acggcgcgac cgacgagctt ccccagaagg cgacgctgct caccgcccgc       360
     gaggtcgacc cagccggcgg cgacacggag ttcgccaaca cctacgccgc ctacgaggca       420
     ctctccgacg aggagaaggc cgagatcgcc gacctccaag tggttcacag cttcgcgatc       480
     gcccagcgaa tcgcgtaccc cgacgccgca gacaagcagc gggccagttg ggagaaggtg       540
     ccgacgaggg tgcacccgct cgtgtggacc cgtgcaaacg ggcggaagtc cctgctgatc       600
     ggagcgaccg cgggcatggt cgtcggccgg tcagaagatc gcggcaggac actgctggac       660
     cgcctgcttc agtggtcaac cagcccgcgg ttcaccctcc ggcaccagtg gcgccgcggc       720
     gacctggtga tctgggacaa caccggcgtg ctccaccgtg ccctgccttt cgagccgacc       780
     tcacgccggc tgatgcaccg caccacgctc gtcggccagg agctcgtcac agcccggtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page