(data stored in ACNUC7421 zone)

EMBL: CP000820.PE509

CP000820.PE509       Location/Qualifiers
FT   CDS_pept        602210..603124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0517"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mpa:MAP2524c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09978"
FT                   /db_xref="GOA:A8KX75"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX75"
FT                   /protein_id="ABW09978.1"
FT                   /translation="MRIGLTGGASTPEKIIDQARKAEADGFHHLWYASVVQGDPLASMA
FT                   LAGRQTSTIELGTAVLQTYPCHPLLQAQRAASVTAAMGRPGFTLGLGPSHAGHIHAEYG
FT                   LSYDRPGKNTEDYLRIVTTLLRDGGADITGEEWSTHVRSGTVQPAHPVPVLLAALSPRL
FT                   LRVAGEHADGVILWMAPATAIEKHIEPKLSAAAKAAGRGALRIVAGLPVAVHDDESEAR
FT                   AAVAKNSTMYASSPAYQRIMAIGGADSPAQAAIAGDEASVERQLHALLDAGATDIWAQP
FT                   IPVGDDPRASLRRTRNLLAALAR"
     atgcgcatcg gactcaccgg cggcgcctcg acccccgaga agatcatcga ccaggcgaga        60
     aaggcggaag ccgatggctt ccaccacctg tggtacgcga gcgtcgtcca aggcgacccg       120
     ttagcgtcca tggcgctcgc gggccgccag acatcgacga tcgagctcgg caccgcggtg       180
     ctgcagacct acccgtgtca tccgctgctc caggcccagc gggcggcgtc ggtcacggcg       240
     gcgatgggcc ggccgggctt cacgcttggt ctcggcccat cgcacgcggg acacatccac       300
     gccgagtacg gcctgtccta cgaccggccg ggcaagaaca ccgaggacta cctccgcatc       360
     gtcaccaccc tgctgcgcga tggcggagcg gacatcaccg gcgaggaatg gagcacgcac       420
     gtgcgttccg ggaccgtaca gccggcgcac ccggtgcccg tgctgctcgc cgcgctctca       480
     ccgcggctgc tgcgggtcgc gggcgagcac gccgacggcg tgatcctctg gatggcgccc       540
     gcgaccgcga tcgagaagca catcgagccg aagctgtcgg ccgcggcgaa ggcggcgggc       600
     cgcggcgcgt tgcggatcgt cgccgggctc ccggtcgccg tgcacgacga cgagtccgaa       660
     gcccgcgcgg ccgtcgcgaa gaactcgacg atgtacgcca gctcgccggc ctaccagcgg       720
     atcatggcaa tcggcggcgc cgatagcccc gcgcaggccg cgatcgccgg cgacgaggcg       780
     tcggtcgaac ggcagctgca cgcgctgctc gacgcgggcg cgaccgacat ctgggcacag       840
     ccgatcccgg tcggcgacga cccgcgcgcc tcgctgcgcc gcacccgcaa cctgctcgcc       900
     gctctggccc ggtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page