(data stored in ACNUC7421 zone)

EMBL: CP000820.PE51

CP000820.PE51        Location/Qualifiers
FT   CDS_pept        65379..66158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0052"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   syg:sync_0860 3-oxoacyl-(acyl-carrier protein) reductase
FT                   BH0932"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09520"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB59"
FT                   /protein_id="ABW09520.1"
FT                   /translation="MDLHLSGKVALVTGGSRGIGRAIVSRLAAEGCRVGICGRDSDALV
FT                   QAAASLDLAESDVFSLTADVTRPGDVERFVEGAAEYFGGVDLLVANVGGTVGGDLLDST
FT                   PEDWAQTFELNAGHAVRAIRSAVPHMKKNGGGSVVIVSSISASKPSPRAQYGAAKVAEI
FT                   YLASAFARELGPFNVRVNAVSPGSILFPGGGWENYARQHPEDFETFVQRDFPAHRLGTA
FT                   EEVADVVTFLLSDRASWVNGADIAVDGAQGRPSARGY"
     gtggatcttc atttgagcgg taaggtcgcg ctcgtcactg gtggttcccg cggcatcggc        60
     cgggcgatcg tgtcccggtt ggcggccgag ggttgccggg tcgggatctg cggacgggac       120
     tccgacgcct tggtccaggc cgcagcgagt ctcgacctgg ccgagtcgga cgtcttcagc       180
     ctgacggccg acgtgaccag gcctggcgat gtagaacggt tcgtcgaggg ggcggccgag       240
     tacttcgggg gcgttgacct gctggtcgcg aacgtcggcg gcaccgtcgg aggggatctt       300
     ctcgactcca cccctgagga ctgggcgcag acgttcgagc tcaacgccgg ccacgccgtc       360
     cgggcgatcc gcagcgcggt cccgcatatg aagaagaacg gcggcgggtc ggtcgtcatc       420
     gtctcgtcga tctcggcgtc gaagccgtcg ccgcgggcgc agtacggggc ggccaaggtc       480
     gcggagatct acctggcgtc ggccttcgcc cgggagttgg ggccgttcaa cgtgcgggtc       540
     aacgcggtga gccccgggtc gatcctcttc cccgggggcg gctgggagaa ctacgcccgc       600
     cagcatccgg aggacttcga gacgttcgtg cagcgggact tccccgcgca caggctgggc       660
     accgccgagg aggtcgcgga cgtggtgacc ttcctgctgt ccgaccgggc tagctgggtg       720
     aacggagccg acatcgccgt cgacggcgcc cagggccggc cgagcgcccg cggctactga       780
//

If you have problems or comments...

PBIL Back to PBIL home page