(data stored in ACNUC7421 zone)

EMBL: CP000820.PE510

CP000820.PE510       Location/Qualifiers
FT   CDS_pept        603227..603784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09979"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX76"
FT                   /protein_id="ABW09979.1"
FT                   /translation="MTTPSELEELRREVRYLRDRQDILDCVNKQSRGHDRHDANLMTSV
FT                   LHEDAIDEHGPAAHIGADYGPWANKQHSEVFANHLHNITTHTCEIEGDIAHAESYVIGT
FT                   MVGRDGKTLAFMGGRYLDRLERRDGAWKIALRRCTIEWAFTANASFLHSGAFKGFLKGT
FT                   WDTTDLSYARPLQLDTGPAVRW"
     atgaccacgc ccagcgaact tgaggaactg cgccgcgagg tccgctatct cagggaccgg        60
     caagacatcc tcgactgcgt caacaagcag tcgcgcggcc acgaccggca cgacgccaac       120
     ctgatgacga gtgtgctgca cgaggacgcg atcgacgagc acggacccgc cgcgcacatc       180
     ggcgcggact acggcccgtg ggcaaacaag cagcactcgg aggtgttcgc caaccatctc       240
     cacaacatca cgacgcatac ctgtgagatc gaaggagaca tcgcgcacgc cgagagctat       300
     gtcatcggca ccatggtcgg ccgcgacggc aagacgctcg ccttcatggg cggccgctac       360
     ctcgaccggc tggagcgccg cgacggtgcc tggaagatcg cccttcggcg ctgcacgatc       420
     gaatgggcct tcaccgccaa cgcctcgttc ctgcactccg gcgccttcaa gggcttcctg       480
     aagggcacct gggacaccac cgacctgtcc tacgcccgcc ccctgcaact ggacaccggc       540
     cccgccgtcc gctggtag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page