(data stored in ACNUC7421 zone)

EMBL: CP000820.PE512

CP000820.PE512       Location/Qualifiers
FT   CDS_pept        complement(605917..606735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0520"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix
FT                   type 11 domain protein; KEGG: fal:FRAAL2991 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09981"
FT                   /db_xref="GOA:A8KX78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX78"
FT                   /protein_id="ABW09981.1"
FT                   /translation="MPTSYVCRPHPTGARYAPKSQIDTLVVSGDSSYAESIRMNIEKTS
FT                   GFAVGAVALTGGQSIRLLTHNSYDLVILDLDLSDMAGLEVCRSIRSRSAGPDIIAVTAD
FT                   RELATVRVAVSYRVIHYLVKPFDFADFRARLHRYALFRQQVADNVTGQIGQREIDSALA
FT                   MLSPDPTAQPKAPKGLTTVTLDAIVTCLRAASTPVSSDDVARTLGISRVTARRYLERLT
FT                   QERLAIRRQRYGRPGRPEHLYCWRAGNQGPETVHMGQGARRDPENLPYRS"
     atgccaacat catacgtctg ccgccctcac cccaccggag cgcggtacgc accaaaaagc        60
     cagattgaca ccctggtcgt cagcggcgac tcgtcgtatg ccgagtccat caggatgaac       120
     atcgagaaga cctccggatt tgccgttggt gcggtggctc tcactggcgg ccagtccata       180
     cggctactca cccacaactc gtatgatctg gtcatactcg acctcgacct gtccgatatg       240
     gctggccttg aagtatgtag gtcaattcgg tcccgtagcg cggggccgga cataatcgcc       300
     gtcaccgccg accgtgaact tgcaacagtc cgagtagccg tctcctacag agtcattcat       360
     tacctggtga agcctttcga ttttgccgac ttccgggccc gcctccaccg gtatgcgcta       420
     ttccgacagc aggtcgcgga taatgtcacc ggccagatag gccagcgcga gatcgattcc       480
     gctctggcca tgctgtcgcc agaccccacg gcgcagccaa aggccccgaa gggcctgacc       540
     acggtgacac tcgatgccat cgtcacgtgt ctgcgcgcgg cgtccacgcc ggtctcgtcg       600
     gacgatgttg ccagaacatt aggcatttcc cgagtaaccg cccgacgtta cctcgaacgg       660
     ttgacccagg aacggctggc aatccgccgc caacgttacg gccggcccgg acgcccggag       720
     cacctctact gttggcgggc agggaatcaa ggacctgaaa ccgttcacat gggccagggg       780
     gcccgaagag atcccgaaaa tctcccctac cgatcttga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page