(data stored in ACNUC7421 zone)

EMBL: CP000820.PE513

CP000820.PE513       Location/Qualifiers
FT   CDS_pept        complement(606994..608250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0521"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   mba:Mbar_A3090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09982"
FT                   /db_xref="GOA:A8KX79"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX79"
FT                   /protein_id="ABW09982.1"
FT                   /translation="MHFSAKRDFLITERRVEYPVAGRRLRIATGAAASGAALATVGIFY
FT                   LRASMHPSGLGGEAETRAMVECVLLIASVALATLAGYRVAADGMRQAYAQAWKAGIREK
FT                   DSNAHFCAREFFGRAVDRLGSENNTTRLGGIYALERIAMDSPSDQRAVVEVLSAFIRTR
FT                   STDPTLRPAVSGPVVPLRPAVDIHAAVAVLGRLSVLDGVPRADLSGAKLTGPAALHCIQ
FT                   ASYGNLSNTDLTGADLSRAHLGRADLTASRLGGTDLTGASLNEANLSYTWLGGANLTRA
FT                   RLSGADLTGASLSGADLTRAWLDGADLTGASLGGANLTRAWLTEADLTRAWLGGANLIT
FT                   AVGLVQDQIDAAYGDGWTRLPPELTRPALWTSAEADEYRPADPHQVVGQWHPEVLAGQD
FT                   NALSSRDYHHTILPKVVIV"
     atgcattttt ccgctaagcg cgactttctg attactgaaa ggagagtgga gtatccagtc        60
     gctgggcggc ggttgcggat cgctactggg gccgcagcgt cgggggctgc gctggcgacg       120
     gtggggatct tctacctgcg cgcctcgatg cacccgtctg gcctcggcgg agaagcggag       180
     actcgggcga tggtggagtg cgtgttgctg attgcgtcgg tcgcgctagc gacgctggcc       240
     ggctaccggg tcgccgcgga cgggatgcga caagcgtacg cgcaggcatg gaaagcgggc       300
     atccgggaaa aggacagcaa tgcccacttt tgtgcccggg agttcttcgg ccgcgcggtc       360
     gaccggctcg gcagcgagaa caacacgact cgccttggcg ggatctacgc cctggagcgg       420
     atcgcgatgg actcaccgag tgaccagcgc gcggtcgtcg aggtcctctc cgccttcatc       480
     cgcacccgca gcacggaccc cacgctgcgg cccgccgtgt ccggtccggt cgttccgctg       540
     cgccctgccg tggatatcca cgccgcggtg gcggtcctgg ggcgtctgtc cgtcctcgac       600
     ggtgtccccc gcgcggactt gagcggtgcg aagctgacag gtcccgccgc cctgcactgc       660
     atacaggcca gctatggcaa cctcagcaac accgacctca ccggagcgga cctcagccgc       720
     gcccatctgg gtcgggcgga cctcactgcc agccggctgg gcggcacgga tctcacgggc       780
     gcctcgctga acgaggccaa cctcagctat acctggttgg gcggagcgaa cctgacccgc       840
     gcccggctaa gcggagcgga tctcaccggt gcatcgctaa gcggagcgga cctgacccgc       900
     gcctggctgg acggcgcgga tctcacgggc gcatcgctag gcggagcgaa cctgacccgc       960
     gcctggctga ccgaggcgga cctgacccgc gcctggctgg gcggggcgaa cctcatcact      1020
     gcggtgggac tggtccagga tcagatcgac gcggcatacg gcgacgggtg gacgcggcta      1080
     ccgccggaac taacgagacc ggctttgtgg acctcggccg aggctgacga gtaccgcccg      1140
     gcagacccac accaggttgt cggacagtgg catccggagg tgctggcggg gcaggacaac      1200
     gccctgtcct cccgggacta tcaccacacg atccttccga aggtcgtgat tgtgtga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page