(data stored in ACNUC7421 zone)

EMBL: CP000820.PE514

CP000820.PE514       Location/Qualifiers
FT   CDS_pept        complement(608380..609036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09983"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX80"
FT                   /protein_id="ABW09983.1"
FT                   /translation="MTLGLTILLPESESLRLGPGGSLSKRLILRVDRNGARELRNAIFN
FT                   DNQTRLEGGLVKEWPRLPPSCLRQVWKQFAIVVGGILLALLAAANLPGPSARPAGIGAS
FT                   GVMPGASANATDRIPQLLRRYAQTAVPSLPSDAAPTRATRATVVVPNVVGLDLRTAEGL
FT                   LFPSLLPSAIDDPAWRGRRTVGPRWVVVTQKPVAGSQVPALTTIDLYAVEPRESD"
     atgaccctgg ggcttacgat cctacttcca gaatcggaga gcctcagatt gggtcccggt        60
     ggatcgttgt cgaagcgact gattctccga gttgacagaa acggtgcgcg ggagttaaga       120
     aatgcaatct ttaatgacaa tcaaactagg ctggagggcg gactggtgaa agaatggccg       180
     cgactcccgc cgtcgtgcct gcgacaggtc tggaagcagt tcgcgatcgt tgtcggcgga       240
     atccttctgg cgctcctggc ggcggcgaat cttcccggcc cgtccgcgcg gccggcaggc       300
     atcggtgctt cgggggtcat gccgggagcg agcgcgaatg cgacggaccg gataccacag       360
     ctgttacgcc gatacgccca gactgctgtc ccttcgctcc cttcagatgc cgccccgacc       420
     agagccaccc gagctacggt cgttgtcccc aacgtggtcg gcctggacct gcggacggcg       480
     gagggcctgc ttttcccctc gctattaccc agtgccatcg atgatccagc ctggcgcgga       540
     cggcggaccg tcgggccgcg ctgggtggtc gtgacgcaaa agccggtagc cggcagccag       600
     gtgccagcgc tgaccactat cgatctgtac gcggtcgagc ctcgggagtc ggattga          657
//

If you have problems or comments...

PBIL Back to PBIL home page