(data stored in ACNUC7421 zone)

EMBL: CP000820.PE515

CP000820.PE515       Location/Qualifiers
FT   CDS_pept        609387..610772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0523"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: fal:FRAAL3306
FT                   putative serine/threonine-protein kinase PkwA; WD40
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09984"
FT                   /db_xref="GOA:A8KX81"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX81"
FT                   /protein_id="ABW09984.1"
FT                   /translation="MQRYCTGQSVPVEFGTIERVARVCGADGDEIARLFRLWETAASIS
FT                   TSAGIELPTAGGDHEHTNPVEGVEYSTSPVSLVPPALAAADDSAPRPATQNEHSRLRGA
FT                   RRAGWRWNRRSISATAIIVVLFSSAVGTVLVLAMILAREPGVRPLGRPLADQAGWALST
FT                   AFSPDGKVMASSSRKGGVWLWNMADPATPVRIDPALTGPRDGVTSLAFSPDGSLLAGGS
FT                   WDGSIWLWDITDSGASKPAGRALTDDSGPIWSVAFSADGRTLASGSDDTTVRLWDMTNR
FT                   ARPWQFVRLSSDMEFVTSVAFSADNRLLVAAGFSRTIAIWDMADRGAPKRLAQSLSTPA
FT                   TTYVAAFSPNGRLLATGSTDGLVRLWDLAVPEDPHPIGRPLTGHTNRVWSLAFSPDGGT
FT                   LASSGFDNSVRLWDVTDLSNPEPIGAPLTGYQGWVLSVRFSPNGRVLASTSSDSTIRLW
FT                   SLP"
     gtgcagcgct actgcacagg ccagtccgtg ccagtagagt tcggcaccat cgaacgcgtc        60
     gcgcgagtat gcggcgccga cggggacgaa atcgcacgcc tgttcagact ctgggaaact       120
     gcggcgtcga tctcgacgag cgccggcatc gaacttccca ccgcaggcgg cgaccatgag       180
     cacaccaatc ctgttgaagg cgtcgagtac tcaacctctc cggtctctct ggtgccacca       240
     gcactcgcag ccgcggacga ctccgcacca agaccagcca cacagaatga gcacagccgg       300
     cttcgcggcg cacgcagagc cggctggaga tggaaccgcc ggagtatatc cgccacggcc       360
     atcatcgtgg tgttgttctc cagcgcggtc ggtaccgtac tcgttctcgc catgattctc       420
     gcgcgtgaac ctggcgtccg gccgctcggg cgcccgttgg ccgaccaggc cggctgggcg       480
     ttgtccaccg cgttctcccc cgacgggaaa gtaatggcta gcagtagcag gaaaggcgga       540
     gtgtggttgt ggaacatggc cgatcccgcc acgcccgtcc gaatcgatcc tgcgctgacc       600
     ggcccacgcg acggggtgac atcactggcg ttctcgccag atgggagtct tttagccggt       660
     ggcagctggg acgggtccat atggttgtgg gacataaccg acagcggggc ttccaagccg       720
     gccggccgtg cgctgaccga cgactcggga ccgatatggt cggtagcatt ctccgcggat       780
     ggccgcacgc tcgcatccgg cagcgacgat acgacggtgc gactttggga catgaccaac       840
     cgcgccaggc cgtggcaatt cgtgcggctg agcagcgata tggagttcgt gacatcggtc       900
     gcgttctccg cggacaaccg cctcctagtc gccgccggct tcagtaggac catcgcgatc       960
     tgggatatgg ccgaccgtgg ggcccctaaa cggctggccc aatccctgtc aacgcccgcc      1020
     actacgtacg tggccgcctt ctcccccaat ggacggctcc ttgccaccgg gagcaccgat      1080
     ggcttggtgc gactttggga cctcgccgtt ccagaggacc cccatccgat cgggagaccg      1140
     ctcaccgggc ataccaaccg cgtctggtca ctcgcattct ctccggatgg cggcaccctc      1200
     gccagcagcg ggttcgacaa ctccgtgaga ctgtgggacg tgaccgacct gtccaacccg      1260
     gagcccatcg gcgcgccact caccggctac cagggctggg ttctctcggt gcgcttctcc      1320
     ccgaacggcc gcgtgctggc aagcaccagc agcgacagca ccatccgcct atggtcgcta      1380
     ccctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page