(data stored in ACNUC7421 zone)

EMBL: CP000820.PE519

CP000820.PE519       Location/Qualifiers
FT   CDS_pept        614951..615556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0528"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: sco:SCO4072 LuxR family two component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09988"
FT                   /db_xref="GOA:A8KX85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX85"
FT                   /protein_id="ABW09988.1"
FT                   /translation="MIKVLLADDENLIRGALAVLLSMEDDITVVAQAASGPEALATARL
FT                   HRPDVALLDLQMPGLDGIAVAQALHADLPACANVIVTSHGRPGYLRRALAAGARGFLPK
FT                   TVSVQVLADVVRVVHGGGRYVDPELAAEAIAAGDSPLTPREAEVLELAAGGAPVEEIAA
FT                   RLSLSRGTVRNYLSSAVAKLGAVNRHEAVQLARVRGWI"
     atgatcaagg tgctgctcgc cgatgacgag aacctcatcc gcggcgcgct ggcggtgctg        60
     ctgtccatgg aggacgacat cacggtggtc gcgcaggcgg catccgggcc ggaggcgctg       120
     gcgacggccc ggctccaccg ccccgacgtc gcgctgctcg acctgcagat gcccggcctg       180
     gacggcattg ccgtcgccca ggcgctgcac gccgacctgc ccgcgtgcgc caacgtgatc       240
     gtgaccagcc acgggcggcc cggctatctc aggcgggcgc tcgccgccgg agcgcgcggc       300
     ttcctgccca agaccgtgtc cgtgcaggtg ctcgccgacg tggtgcgggt ggtgcacggc       360
     ggcggccggt acgtggaccc ggagctggcg gccgaggcga tcgcggccgg ggacagcccg       420
     ctgacgccgc gcgaggcgga ggtgctggag ctggccgccg gcggcgcgcc ggtggaggag       480
     atcgcggcac ggttgtcgct gtcgcggggc accgtgcgca actacctgtc gtcggcggtc       540
     gccaagctgg gcgcggtcaa ccggcacgag gccgtccagc tcgcccgcgt ccgcggctgg       600
     atctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page